BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G01 (451 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0356 + 17141107-17141165,17141502-17141650,17141748-171419... 29 2.3 >10_08_0356 + 17141107-17141165,17141502-17141650,17141748-17141969, 17142051-17142187,17142319-17142570,17143915-17144063, 17144476-17144540,17144633-17144701,17145014-17145144, 17145218-17145505,17145669-17145811,17145898-17145951, 17146000-17146080,17149048-17149222,17149223-17149647, 17149929-17150144,17150279-17150309 Length = 881 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -3 Query: 449 PYISILIFVV----CIIFELLPAGVTNL*IRSFY*FTLHCF 339 PY SI F+ CI+ LPA N IRS Y + LH F Sbjct: 598 PYCSIYFFLYSPCDCILVSFLPAPAFNSWIRSVY-YILHVF 637 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,956,922 Number of Sequences: 37544 Number of extensions: 130796 Number of successful extensions: 194 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 194 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -