BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F20 (188 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 34 0.016 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 34 0.016 SB_50003| Best HMM Match : PAN (HMM E-Value=0.044) 32 0.085 SB_39673| Best HMM Match : TRAP-delta (HMM E-Value=1.2e-32) 31 0.11 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 31 0.11 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 30 0.26 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 0.26 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 30 0.34 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.45 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 0.60 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 0.60 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 29 0.60 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.60 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 29 0.79 SB_5331| Best HMM Match : Fork_head (HMM E-Value=0) 29 0.79 SB_50351| Best HMM Match : I-set (HMM E-Value=0.00016) 29 0.79 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 0.79 SB_27564| Best HMM Match : IPT (HMM E-Value=8.6) 29 0.79 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.79 SB_50539| Best HMM Match : IL17 (HMM E-Value=4.1) 28 1.0 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 28 1.0 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_16410| Best HMM Match : DUF1306 (HMM E-Value=5.7) 28 1.4 SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) 28 1.4 SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 28 1.4 SB_39819| Best HMM Match : Extensin_2 (HMM E-Value=1) 28 1.4 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 28 1.4 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 27 1.8 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 27 1.8 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 27 1.8 SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19) 27 1.8 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) 27 2.4 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 27 2.4 SB_21820| Best HMM Match : DUF622 (HMM E-Value=2.7) 27 2.4 SB_10727| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) 27 2.4 SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) 27 2.4 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 27 3.2 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_18985| Best HMM Match : TUDOR (HMM E-Value=8.3e-37) 27 3.2 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 27 3.2 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) 26 4.2 SB_8025| Best HMM Match : MNSV_P7B (HMM E-Value=3.8) 26 4.2 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 26 4.2 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_51860| Best HMM Match : ShTK (HMM E-Value=1.5e-09) 26 5.6 SB_32562| Best HMM Match : IATP (HMM E-Value=6) 26 5.6 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_59727| Best HMM Match : C2 (HMM E-Value=0.0018) 26 5.6 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_46953| Best HMM Match : DUF1014 (HMM E-Value=0.83) 26 5.6 SB_45285| Best HMM Match : AT_hook (HMM E-Value=0.13) 26 5.6 SB_38740| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 26 5.6 SB_17742| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 25 7.4 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_14600| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 25 7.4 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 25 9.7 SB_52562| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) 25 9.7 SB_36313| Best HMM Match : Crl (HMM E-Value=5.1) 25 9.7 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_20598| Best HMM Match : Herpes_UL49_2 (HMM E-Value=6.4) 25 9.7 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) 25 9.7 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_47634| Best HMM Match : Metallophos (HMM E-Value=1e-11) 25 9.7 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 25 9.7 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 25 9.7 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 25 9.7 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_11737| Best HMM Match : Glyco_hydro_65m (HMM E-Value=0) 25 9.7 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 34.3 bits (75), Expect = 0.016 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 123 TLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 T +APP P A R P + PC + APP PP Sbjct: 155 TPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAPPRLPP 191 Score = 25.4 bits (53), Expect = 7.4 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 10/57 (17%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSR------RAHRPPPRTPCGNRAP-PSTP---PCAS 4 S+ P T Q +PP+ T S+ A PP P + P PSTP PC S Sbjct: 127 STTPQHPTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPS 183 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 34.3 bits (75), Expect = 0.016 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 PP AP S+ PPP T RAPP PP A Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIA 145 Score = 31.1 bits (67), Expect = 0.15 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 P T RAPP P A + PPP PP PP A Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIA 171 Score = 29.5 bits (63), Expect = 0.45 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 P T + +PP PT+ + RA PPP PP PP A Sbjct: 117 PETPSQAPSPPP-PPTSPATRAPPPPPPIAPATGGPPPPPPIA 158 >SB_50003| Best HMM Match : PAN (HMM E-Value=0.044) Length = 286 Score = 31.9 bits (69), Expect = 0.085 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = -3 Query: 120 LQRAPPLLAPTAGSRRAHRPPPRTPCGN-----RAPPSTPP 13 +Q+ PP PTA +A P P P N A PSTPP Sbjct: 53 VQQLPPAPQPTANPEKAEEPQPLKPLDNYTSAAAAVPSTPP 93 >SB_39673| Best HMM Match : TRAP-delta (HMM E-Value=1.2e-32) Length = 504 Score = 31.5 bits (68), Expect = 0.11 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -3 Query: 135 PSTGTLQ-RAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 PS+ +L R PP+L A S+R RPPPR+ NR PS+P Sbjct: 465 PSSSSLAVREPPVLL-LALSQRTARPPPRSKSENR--PSSP 502 Score = 29.5 bits (63), Expect = 0.45 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 PS+ R PP+L A S+R RPPPR+ PP Sbjct: 376 PSSSLAVREPPVLL-LALSQRTARPPPRSNQRTARPP 411 Score = 28.3 bits (60), Expect = 1.0 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 135 PSTGTLQ-RAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 PS+ +L R PP+L A S+R RPPPR+ PP Sbjct: 420 PSSSSLAVREPPVLL-LALSQRTARPPPRSNQRTARPP 456 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 31.5 bits (68), Expect = 0.11 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Frame = -3 Query: 165 SGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPP-------PRTPCGNRAPPSTP 16 SGA ++ P+TG + AP PT+GS A++P P T + PSTP Sbjct: 566 SGAPASGATTPTTGPISGAPASNGPTSGSTGANQPTSGSTSANPTTSSATGSQPSTP 622 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 30.3 bits (65), Expect = 0.26 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 129 TGTLQRAPPLLAPTAGSRRAHRPP--PRTPCGNRAPPSTPPCASC 1 +GTL PP P G PP P+ C PP PP C Sbjct: 706 SGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGC 750 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P G PP +P G PPP P G P PP Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.3 bits (65), Expect = 0.26 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 P TGTL PP + P G PPP TP P PP A Sbjct: 125 PPTGTLP--PPPVTPPPGPETP--PPPDTPAPPVPPTEAPPTA 163 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.9 bits (64), Expect = 0.34 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 105 PLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 PL P G +PPP P GN PP PP S Sbjct: 931 PLPPPPPGGSAPSQPPP--PGGNAPPPPPPPGGS 962 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -3 Query: 111 APPLLAPTAGSRR---AHRPPPRTPCGNRAPPSTPP 13 APP P GS PP P G APP PP Sbjct: 952 APPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 Query: 96 APTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +P+A PPP P G AP PP Sbjct: 909 SPSASPPGGSVPPPPPPPGGNAPLPPPP 936 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.9 bits (64), Expect = 0.34 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P G APP P A PPP P G APP PP Sbjct: 667 PPGGQAGGAPPPPPPPLPGGAA--PPPPPPIGGGAPPPPPP 705 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPC-GNRAPPSTPP 13 PP P G PPP P G APP PP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 93 PTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P AG PPP G PP PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPP 682 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.9 bits (64), Expect = 0.34 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P TG + PP P G A PPP P G APP PP Sbjct: 285 PLTGGM--LPP---PFGGHPAAAPPPPPLPAGVPAPPPPPP 320 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 0.34 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = -3 Query: 150 HLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 H++ P T T APP PT PPP P PP PP Sbjct: 883 HVTKNPKTTT---APPT-TPTTPKPTTPAPPPPLPLAPEPPPPLPP 924 Score = 27.9 bits (59), Expect = 1.4 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -3 Query: 147 LSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP--CAS 4 L S PST ++ +PP++ P + P C N +P + P CAS Sbjct: 1782 LPSCPSTCCIKNSPPVVCPKSCETTCTPDCPVMCCKNSSPATECPTICAS 1831 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 0.45 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHR-----PPPRTPCGNRAPPSTP 16 P T+ RAPP G R + PPP P PP+TP Sbjct: 24 PPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTP 68 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 PP P G PPP TP PP+TP Sbjct: 73 PPPNTPIPGD-----PPPNTPIPGNPPPNTP 98 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 PP P G+ PPP TP PP+TP Sbjct: 83 PPPNTPIPGN-----PPPNTPIPGDPPPNTP 108 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTP 16 PPP TP PP+TP Sbjct: 63 PPPNTPIPGDPPPNTP 78 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTP 16 PPP TP PP+TP Sbjct: 103 PPPNTPIPGDPPPNTP 118 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.1 bits (62), Expect = 0.60 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPP-RTPCGNRAPPSTPP 13 PP+ P +R A PPP R P PP PP Sbjct: 344 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.1 bits (62), Expect = 0.60 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPP-RTPCGNRAPPSTPP 13 PP+ P +R A PPP R P PP PP Sbjct: 256 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 29.1 bits (62), Expect = 0.60 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 H + +P T AP P A PPP P G PP PP Sbjct: 275 HDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 29.1 bits (62), Expect = 0.60 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGN-RAPPSTPP 13 P+ G+ APP P G+ PPP P G+ APP PP Sbjct: 296 PADGSAP-APPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.1 bits (62), Expect = 0.60 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 138 LPSTGTLQRAPPLLAPTAGSRRAHRPPPR----TPCGNRAPPSTPP 13 +P G + PP L P G R PPP P G PP PP Sbjct: 445 MPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPP 490 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 28.7 bits (61), Expect = 0.79 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -3 Query: 135 PSTGTLQ-RAPPLLAPTAGSRR----AHRPPPRTPCGNRAPPSTPPCASC 1 P +G L A P PT G+ ++PPP P +APP T SC Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAPGSC 255 >SB_5331| Best HMM Match : Fork_head (HMM E-Value=0) Length = 503 Score = 28.7 bits (61), Expect = 0.79 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 165 SGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPR 52 +GA H+ ++ TG L AP PT S H PPP+ Sbjct: 333 AGAIHYYNACIHTGVLTPAP---TPTNVSPTGHEPPPK 367 >SB_50351| Best HMM Match : I-set (HMM E-Value=0.00016) Length = 419 Score = 28.7 bits (61), Expect = 0.79 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -3 Query: 165 SGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +G SS P GT+++ + T S + PPP ++ PSTPP Sbjct: 263 TGQSDKQSSPPPHGTVRQTIISSSLTGQSDKQSSPPPSRGQSDKQSPSTPP 313 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PS G + P PT S + P P N+ TPP Sbjct: 299 PSRGQSDKQSPSTPPTVQSDKQSPPTPSRGQSNKQSSPTPP 339 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 28.7 bits (61), Expect = 0.79 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 PS G P AP R PPP APP PP S Sbjct: 291 PSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRS 334 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 P ++ APP P G+ A PPP P G PP P Sbjct: 346 PPPPSMGMAPP---PVGGA--APPPPPPPPVGGPPPPPPP 380 >SB_27564| Best HMM Match : IPT (HMM E-Value=8.6) Length = 220 Score = 28.7 bits (61), Expect = 0.79 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 93 PTAGSRRAHRPPPRTPCGNRAPPSTP 16 P RR HR PP + G +AP S P Sbjct: 6 PLKAVRRLHRQPPSSKRGRQAPTSRP 31 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 0.79 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P+ T PP P + PPP P N PP PP Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP P + PPP P N PP PP Sbjct: 379 PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP P + + PP P N+ PP PP Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 >SB_50539| Best HMM Match : IL17 (HMM E-Value=4.1) Length = 456 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 P+TG + P+LA SR+ + + G+ PPS P C S Sbjct: 242 PTTG---KRSPVLAQLLKSRKNSKESAGSKIGSPCPPSNPSCKS 282 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 84 GSRRAHRPPPRTPCG-NRAPPSTPP 13 G+ + H PPP+ P N+ PP PP Sbjct: 54 GNIQGHVPPPQMPMAPNQMPPQNPP 78 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +R P + GSRR+ PP R P R+P ++PP Sbjct: 1076 RRTPEDRRRSRGSRRSPSPPKREP-RRRSPSASPP 1109 >SB_16410| Best HMM Match : DUF1306 (HMM E-Value=5.7) Length = 396 Score = 27.9 bits (59), Expect = 1.4 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 123 TLQRAPPLL--APTAGSRRAHRPPPRT-PCGNRAPPSTP 16 TLQ P L AP R HR PR P GN APP P Sbjct: 122 TLQNLRPRLPDAPRHDDRPQHRASPRNFPVGN-APPKQP 159 >SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) Length = 347 Score = 27.9 bits (59), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 96 APTAGSRRAHRPPPRTPCGNRAPPSTP 16 A T R HRP P P APPSTP Sbjct: 4 ATTVTGTRRHRPEPPPPLPT-APPSTP 29 >SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 458 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 118 RRCPPLTRCT--NYRKRRCPPLTKCTNYRKRRCPPLTKC 154 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 132 RRCPPLTKCT--NYRKRRCPPLTKCTNYRKRRCPPLTKC 168 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 146 RRCPPLTKCT--NYRKRRCPPLTKCTNYRKRRCPPLTKC 182 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 160 RRCPPLTKCT--NYRKRRCPPLTKCTNYRKRRCPPLTKC 196 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 174 RRCPPLTKCT--NYRKRRCPPLTKCTNYRKRRCPPLTRC 210 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 188 RRCPPLTKCT--NYRKRRCPPLTRCTNYRKRRCPPLTKC 224 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 230 RRCPPLTKCT--NYRKRRCPPLTRCTNYLKRRCPPLTRC 266 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 286 RRCPPLTKRT--NYRKKRYPPLTRCTNYRKRRCPPLTRC 322 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T +R R PP T C N PP C Sbjct: 216 RRCPPLTKCTYYRKR--RCPPLTKCTNYRKRRCPPLTRC 252 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 62 RRCPPLTKCT--NYRKRRCPPLTWCTNYRKRRCPPLTRC 98 Score = 25.8 bits (54), Expect = 5.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 76 RRCPPLTWCT--NYRKRRCPPLTRCTNYRKRRCPPLNKC 112 Score = 25.8 bits (54), Expect = 5.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T +R R PP T C N PP C Sbjct: 104 RRCPPLNKCTYYRKR--RCPPLTRCTNYRKRRCPPLTKC 140 >SB_39819| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 259 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 171 RRCPPLTRCT--NYRKRRCPPLTKCTNYRKRRCPPLTKC 207 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 45 RRCPPLTRCT--NYRKRRCPPLTRCTNYRKRRCPPLTKC 81 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 157 RRCPPLTKCT--NYRKRRCPPLTRCTNYRKRRCPPLTKC 193 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 185 RRCPPLTKCT--NYRKRRCPPLTKCTNYRKRRCPPLTRC 221 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 31 RRCPPLTKCT--NYRKRRCPPLTRCTNYRKRRCPPLTRC 67 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 101 RRCPPLTRCT--NYRKRRCPPLTMCTNYRKRRCPPLTRC 137 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 59 RRCPPLTRCT--NYRKRRCPPLTKCTNYRKRRCPPLTWC 95 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T +R R PP T C N PP C Sbjct: 129 RRCPPLTRCTYYLKR--RCPPLTKCTNYLKRRCPPLTKC 165 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 73 RRCPPLTKCT--NYRKRRCPPLTWCTNYRKRRCPPLTRC 109 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 87 RRCPPLTWCT--NYRKRRCPPLTRCTNYRKRRCPPLTMC 123 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 199 RRCPPLTKCT--NYRKRRCPPLTRCTNYRKRRCPPLTWC 235 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 27.9 bits (59), Expect = 1.4 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 10/58 (17%) Frame = -3 Query: 156 HHHLSSLPSTGTLQRAPPLL--APTAGSRRAH--------RPPPRTPCGNRAPPSTPP 13 HHH SS + + PL+ +PT G R H PP + N PP PP Sbjct: 228 HHHSSSHYKSSSSSSLKPLIPPSPTLGLRDKHLASSSSKGHPPIPSASQNATPPPPPP 285 Score = 25.0 bits (52), Expect = 9.7 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -3 Query: 168 ASGAHHHLSSLPSTGTLQRAPPLLAPTAG--SRRAHRPPPRTPCGNRAPPSTPP 13 +S H + S T PP + T G + +PPP P + APP PP Sbjct: 264 SSKGHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPT-DFAPPPPPP 316 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -3 Query: 87 AGSRRAHRPPPRTPCGNRAPP--STPPCASC 1 A S RA PPP +P G + STPP C Sbjct: 57 AKSTRAPAPPPDSPSGTTSTTDLSTPPANGC 87 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 27.5 bits (58), Expect = 1.8 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P G H S PS APP + P G+ + PP P P TPP Sbjct: 2151 PPPMGPARHSPSGPSP---LGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -3 Query: 147 LSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 L + PS APP P G+ + PP TP P PP Sbjct: 2167 LGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 >SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 291 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T + R R PP T C N PP C Sbjct: 222 RRCPPLTKCT--NYRKRRCPPLTRCTNYLKRRCPPLTKC 258 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T +R R PP T C N PP C Sbjct: 236 RRCPPLTRCTNYLKR--RCPPLTKCTNYLKRRCPPLTKC 272 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PPL T +R R PP T C N PP C Sbjct: 250 RRCPPLTKCTNYLKR--RCPPLTKCTNYRKRRCPPLTRC 286 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 72 AHRPPPRTPCGNRAPPSTPPCASC 1 A P PR P G PP CASC Sbjct: 112 AGAPGPRGPPGPMGPPGPHGCASC 135 >SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19) Length = 851 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPPCAS 4 PPP TP AP S+PP A+ Sbjct: 269 PPPTTPTSAGAPLSSPPSAA 288 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 27.1 bits (57), Expect = 2.4 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 141 SLPSTGTLQRAPPLLAP--TAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 SLP T + P LAP S + P P +R PP PP AS Sbjct: 641 SLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPPEAS 688 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.1 bits (57), Expect = 2.4 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 168 ASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP-STPPCA 7 AS + ++S P A P +AP A PPP P APP PP A Sbjct: 150 ASSSGPSIASQPPQPPAPPAAPFMAPAAPPAP---PPPGAPAAPPAPPFGGPPSA 201 >SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) Length = 127 Score = 27.1 bits (57), Expect = 2.4 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 14 GGVEGGARLPHGVRGGGLCARRLPAVGARSGGARCSVPV 130 GGV GG+ + GV GGG+ + G G V V Sbjct: 83 GGVIGGSVMGDGVMGGGVMGGSVMGGGVMGGSVTAMVVV 121 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 PP + P+ +PPPR PP PP +S Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSS 280 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPS 22 P + + PPL P + +A +PP P G P+ Sbjct: 263 PRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVPA 300 >SB_21820| Best HMM Match : DUF622 (HMM E-Value=2.7) Length = 472 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 49 CPRRRPVCSP-APCRGSEKRRCSLQC 123 CP RR C+P A C G ++R C QC Sbjct: 89 CPGRRYGCTPRANCTG-KRRHCYAQC 113 >SB_10727| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) Length = 215 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPST 19 H S+ + T P A +A S PPP P ++ PPST Sbjct: 94 HERPSMLHSHTPLFPPVRSASSASSFEPVSPPPPVPFSSKGPPST 138 >SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) Length = 930 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 62 GLCARRLPAVGARSGGARCSVPVLGSD 142 G+C RRLPA R G R S G+D Sbjct: 382 GICCRRLPAPRNRKGDWRTSCRGCGTD 408 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 60 PPRTPCGNRAPPSTPP 13 PPRTP PP TPP Sbjct: 147 PPRTPPPEPTPPPTPP 162 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PST + +P + S R+HR R+P +P +PP Sbjct: 488 PSTPPKKTSPDQSRSRSRSPRSHRSTSRSPRRRHSPSVSPP 528 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 26.6 bits (56), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 147 LSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPS 22 L S L PPL P A S PPP P G P S Sbjct: 674 LVEFSSKPPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHS 715 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 120 LQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +QR P + P AG+ PPP + G P PP Sbjct: 368 VQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPP 403 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 60 PPRTPCGNRAPPSTP 16 PP TPC N PPSTP Sbjct: 3103 PPSTPCQN-PPPSTP 3116 >SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 AP PT+ + A PP RTP + PP TP S Sbjct: 120 APTPTTPTSPATPARGPPIRTPIPLKEPP-TPALES 154 >SB_18985| Best HMM Match : TUDOR (HMM E-Value=8.3e-37) Length = 1219 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 855 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 886 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 867 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 898 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 879 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 910 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 891 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 922 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 903 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 934 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 915 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 946 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTGTRQ 138 ARC + + A CRG ++ C +C G ++ Sbjct: 927 ARCRGGKRLSCDARCRGGKRLSCDARCRGGKR 958 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 43 ARCPRRRPVCSPAPCRGSEKRRCSLQCTG 129 ARC + + A CRG ++ C +C G Sbjct: 939 ARCRGGKRLSCDARCRGGKRLSCDARCRG 967 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 26.6 bits (56), Expect = 3.2 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +S P++ + PP P PPP +P R PP PP Sbjct: 192 TSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 PP +P A + A PP P PP+ PP A Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAP-PPPAAPPAA 84 Score = 25.0 bits (52), Expect = 9.7 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTA----GSRRAHRPPPRTPCGNRAPPSTPP 13 H +SS P +PP AP A + A PPP P APP PP Sbjct: 44 HFISSSPPPPP--PSPPAAAPAAPPPPAAAPAAPPPPAAP--PAAPPPPPP 90 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 ++ P+ APP P A PPP P PP PP Sbjct: 69 AAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQ--PPPAPP 110 >SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) Length = 818 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 105 PLLAPTAGSRRAHRPPPRTPCGNRAPPST 19 P A ++ S A P P P N PPST Sbjct: 683 PCTAASSPSTPASSPSPTPPLSNSLPPST 711 >SB_8025| Best HMM Match : MNSV_P7B (HMM E-Value=3.8) Length = 119 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 5 DAHGGVEGGARLPHGVRGGGLC 70 D HG + G R PH G G C Sbjct: 92 DVHGQINGTVRPPHSRGGKGYC 113 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 26.2 bits (55), Expect = 4.2 Identities = 25/69 (36%), Positives = 28/69 (40%), Gaps = 13/69 (18%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPP-LLAPTAGSRRAHRPPPRT------------PCGNR 34 PG G S +T T+ PP AP GS H PPP+T P GN Sbjct: 118 PGHVGGTAGTPSFATT-TINYPPPGPQAPPPGST-VHYPPPQTTMGYPSAQPGFAPPGNY 175 Query: 33 APPSTPPCA 7 PP PP A Sbjct: 176 PPPPAPPPA 184 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 26.2 bits (55), Expect = 4.2 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTP---CGNRAPPSTPP 13 PS + APP P S PPPR P N A P+ PP Sbjct: 1062 PSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -3 Query: 132 STGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 S + Q PP P+ PPPR P + P+ PP Sbjct: 1034 SPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPP 1073 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 +P +LAP PPP P G PP PP A Sbjct: 173 SPGILAPPPAPPGVLAPPPAPP-GVLPPPPAPPGA 206 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 111 APP-LLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 APP +LAP PPP P PP PP Sbjct: 182 APPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -3 Query: 105 PLLAPTAGSRRAH--RPPPRTPCGNRAPPSTP 16 P+ PTA R R P C NR+P S+P Sbjct: 320 PVTTPTAPVEREEGSRSPDHALCSNRSPVSSP 351 >SB_51860| Best HMM Match : ShTK (HMM E-Value=1.5e-09) Length = 197 Score = 25.8 bits (54), Expect = 5.6 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -3 Query: 132 STGTLQRAPPLLAPT----AGSRRAHRPPPRTPCGNRAPPSTPP 13 STG L ++ PL+ PT G + P P T PP+ P Sbjct: 101 STGFLSKSKPLVPPTEISGPGPKETLPPTPATLPPTTVPPAPAP 144 >SB_32562| Best HMM Match : IATP (HMM E-Value=6) Length = 126 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 11 HGGVEGGARLPHGVRGGG 64 +GG++GG LP GV GG Sbjct: 52 NGGIQGGELLPSGVIQGG 69 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 77 RLPAVGARSGGARCSVPVLGSDERWWW 157 RLP+V A G S L D R WW Sbjct: 90 RLPSVDATLRGRDISAQCLPGDARSWW 116 >SB_59727| Best HMM Match : C2 (HMM E-Value=0.0018) Length = 482 Score = 25.8 bits (54), Expect = 5.6 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 HH S+ S L + P PPP P +R P TPP Sbjct: 199 HHNSTYSSPVPLAHSAPATPTQMAVGHVTPPPPTFPVSSRVP--TPP 243 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 84 GSRRAHRPPPRT-PCGNRAPPST 19 G+ H PP+T P NRAPP T Sbjct: 447 GASMGHPIPPQTRPFDNRAPPPT 469 Score = 25.4 bits (53), Expect = 7.4 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = -3 Query: 159 AHHHLSSLPSTGTLQRAPPLLA-----PTAGSRRAHRPPPRTPCGNRAPPST 19 A H +P + APP A P AG P P G APP T Sbjct: 708 AQHKQQQVPQSRDYSDAPPQAARPKPIPDAGPASPTHPVPLGRTGESAPPVT 759 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 138 LPSTGTLQRAPPL-LAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +P + APP+ LAP P + PC + P PP Sbjct: 103 MPLAPPVPLAPPMPLAPPVQQAPCGAGPMQAPCAGQQMPLAPP 145 >SB_46953| Best HMM Match : DUF1014 (HMM E-Value=0.83) Length = 284 Score = 25.8 bits (54), Expect = 5.6 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 7/42 (16%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPP----PRTPC---GNRAPPSTPP 13 Q PP +PT + R H P P +P G+R PP+TPP Sbjct: 192 QTPPP--SPTNYAARKHSHPGLQMPNSPTHRGGDRDPPTTPP 231 >SB_45285| Best HMM Match : AT_hook (HMM E-Value=0.13) Length = 440 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNR 34 HH + S+ +++P L+ G R AH+P G + Sbjct: 157 HHEQNKSSSSLTKQSPGLVRSLKGKRLAHKPSASASPGTK 196 >SB_38740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 131 VPVHCSEHLRFSLPRQGAGEHTGRRRGHRAVTAHRPQRH 15 +P+ C ++ S P H G H A AH P RH Sbjct: 93 LPLRCRSLVQSSRPEP----HEGTTTSHHATDAHVPTRH 127 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 25.8 bits (54), Expect = 5.6 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +2 Query: 11 HGGVEGGARLPHGVRGGGLCARRLPAVGARSG 106 +GG GG R G RGGG RR G+RSG Sbjct: 327 YGGGRGGGRGYGGGRGGG--GRRDYGGGSRSG 356 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 92 PRQGAGEHTGRRRGHRAVTAHR-PQRHRAHR 3 PRQ G H RRR ++ HR ++++ HR Sbjct: 744 PRQNRGRHHHRRRHNKKNRKHRKSKKNKNHR 774 >SB_17742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 96 APTAGSRRAHRPPPRTPCGNRAPPSTP 16 AP R HR PPR APP P Sbjct: 169 APQHDDRPQHRAPPRNFPVENAPPKQP 195 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 25.4 bits (53), Expect = 7.4 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 SS PS+ L PP +P S PPP TP + PP Sbjct: 149 SSTPSSSLLP--PPSSSPPLSSPPP--PPPSTPSSSLLPP 184 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -3 Query: 135 PSTGTLQRAPPLL--APTAGSRRAHRPPPRTPCGNRAPPSTP 16 P+T TL + P PT + AH P TP + TP Sbjct: 86 PTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTP 127 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 25.4 bits (53), Expect = 7.4 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 180 SLPGASGA-HHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNR 34 SLP ++G HH+++ P PP T RA PPP G + Sbjct: 1027 SLPRSNGMLHHNIAHEPIMEEPFPPPPPPYQTGSPIRAFPPPPAVKFGGQ 1076 >SB_14600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 35 RLPHGVRGGGLCARRLPAVGAR 100 R+P G +CARR+P VGAR Sbjct: 187 RIPVGAMKNPVCARRIP-VGAR 207 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -3 Query: 135 PSTGTLQRAPPLLA---PTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P+T T P A P AG+ A PPP PP P Sbjct: 142 PTTPTTAATTPTTAATTPAAGAAAAAAPPPAAAAAAPPPPVGKP 185 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 AP P G+ PPP TP PP P Sbjct: 566 APHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 60 PPRTPCGNRAPPSTPPCA 7 PP TP AP S+ PCA Sbjct: 357 PPSTPAPTPAPLSSTPCA 374 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 78 RRAHRPPPRTPCGNRAPPSTPP 13 RR PPP P + PP PP Sbjct: 137 RRRRNPPPPPPPPSPPPPCHPP 158 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRT---PCGNRAPPSTP 16 PP AP + R+H+ P T P G P S P Sbjct: 1649 PPGTAPVTSAVRSHQGPVNTQGAPLGASVPASAP 1682 >SB_52562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1490 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 17 GVEGGARLPHGVRGGGLCARRLPAVGARSGGARCS-VPVLGSDE 145 G+ GGA+LP G + G +V + S R S +P G + Sbjct: 961 GIPGGAKLPQGHQRGTALTSESSSVTSGSNSERSSPLPFSGGQQ 1004 >SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 114 RAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 R PP A R ++R PP+ P +A P Sbjct: 4 RRPPSAAQRDAYRTSYRGPPKVPNERKARP 33 >SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1164 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 P G + PP+ G +R RP PR P Sbjct: 405 PEKGKALQTPPVDRGGLGPQRRKRPQPRIP 434 >SB_36313| Best HMM Match : Crl (HMM E-Value=5.1) Length = 442 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 AP PT+ + A PP RTP + P+ P Sbjct: 126 APTPTTPTSPATPASGPPIRTPIPLKETPTQP 157 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 HH SLP G P A + GS + P PSTP Sbjct: 1336 HHRVSLPPPGQFSSQPAFPAGSHGSVESGGSPSSGQATPLRAPSTP 1381 >SB_20598| Best HMM Match : Herpes_UL49_2 (HMM E-Value=6.4) Length = 292 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/48 (22%), Positives = 19/48 (39%) Frame = -1 Query: 188 LSNLCRVQAEPTTISHRCRVPVHCSEHLRFSLPRQGAGEHTGRRRGHR 45 +S + +P RC + H S+H P GA T + ++ Sbjct: 178 ISRKSNTKNQPLIGCRRCHMSTHNSDHEHEQAPPMGASRKTSATKANK 225 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 25.0 bits (52), Expect = 9.7 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 8/64 (12%) Frame = -3 Query: 168 ASGAHHHLSSLPSTG-TLQRAPPLLAPTAGSRRAHR----PPPR---TPCGNRAPPSTPP 13 + H++ ++PS +L + P T R P PR TP +++P S PP Sbjct: 879 SESGHYYCYAIPSGRVSLTKNAPKSVQTTSKRPQDNLKNFPSPRKTRTPSSHQSPQSAPP 938 Query: 12 CASC 1 + C Sbjct: 939 SSPC 942 >SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) Length = 814 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRT---PCGNRAPPSTP 16 PP AP + R+H+ P T P G P S P Sbjct: 303 PPGTAPVTSAVRSHQGPVNTQGAPLGASVPASAP 336 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P L PT A PPP PP PP Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_47634| Best HMM Match : Metallophos (HMM E-Value=1e-11) Length = 585 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 Query: 20 VEGGARLPHGVRGGGLCARRLPAVGARSGGARCSVPV 130 V GG + P G G G P++ G C VP+ Sbjct: 363 VSGGEKDPSGAPGEGFHPWFAPSLFHTDSGGECGVPM 399 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPP-PRTPCGN--RAPPSTPP 13 SS P + APP +P+ + +PP P TP + PP PP Sbjct: 318 SSEPDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPP 364 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/53 (26%), Positives = 20/53 (37%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 PG + +P+ Q P RR RP P +P G+ P+ P Sbjct: 283 PGIKSVRVTIDGMPNNVFSQGLRPTDFWREAKRRFVRPSPGSPGGHSGAPAAP 335 >SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013) Length = 808 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 186 F*SLPGASGAHHHLSSL--PSTGTLQRAPPLLAPTAGSRRAHRPPPR 52 F L SG H ++ P APP+ AP RR R PR Sbjct: 604 FKQLESLSGVRHARTTPYHPQGNGKDAAPPVQAPAPARRRRTRQQPR 650 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP+ P A PPP P N PS PP Sbjct: 285 PPMTPPPAV---VTAPPPAPPLPNFTSPSPPP 313 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -3 Query: 126 GTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 G+ Q P + P + A RP R N A P TP Sbjct: 990 GSKQDIPIIATPCTSAPYAERPISRQDVPNLAMPGTP 1026 >SB_11737| Best HMM Match : Glyco_hydro_65m (HMM E-Value=0) Length = 702 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 146 SHRCRVPVHCSEHLRFSLPR 87 SHR R+P C +R ++PR Sbjct: 68 SHRARIPSPCDISVRSNIPR 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,558,993 Number of Sequences: 59808 Number of extensions: 168207 Number of successful extensions: 1267 Number of sequences better than 10.0: 94 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 16,821,457 effective HSP length: 41 effective length of database: 14,369,329 effective search space used: 301755909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -