BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F20 (188 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 42 8e-05 At1g61080.1 68414.m06877 proline-rich family protein 35 0.009 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 32 0.061 At3g50180.1 68416.m05486 hypothetical protein 31 0.081 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 31 0.081 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 0.11 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 31 0.11 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 31 0.11 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 0.14 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 0.14 At5g01840.1 68418.m00103 ovate family protein 59% similar to ova... 31 0.14 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 0.19 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 30 0.19 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 30 0.25 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 30 0.25 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 0.33 At1g67930.1 68414.m07757 Golgi transport complex protein-related... 29 0.33 At1g01730.1 68414.m00092 expressed protein 29 0.33 At5g42635.1 68418.m05190 glycine-rich protein 28 0.75 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 0.75 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 0.75 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 28 0.75 At3g12990.1 68416.m01618 3' exoribonuclease family protein simil... 28 0.99 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 27 1.3 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 27 1.3 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 27 1.3 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 27 1.3 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 27 2.3 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 27 2.3 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 27 2.3 At4g00240.1 68417.m00031 phospholipase D beta 2 / PLD beta 2 (PL... 27 2.3 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 27 2.3 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 27 2.3 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 26 3.0 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 26 3.0 At4g34440.1 68417.m04894 protein kinase family protein contains ... 26 3.0 At3g42130.1 68416.m04326 glycine-rich protein 26 3.0 At3g11590.1 68416.m01416 expressed protein 26 3.0 At2g36290.1 68415.m04453 hydrolase, alpha/beta fold family prote... 26 3.0 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 26 3.0 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 26 3.0 At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein ... 26 3.0 At5g54430.1 68418.m06779 universal stress protein (USP) family p... 26 4.0 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 26 4.0 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 26 4.0 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 26 4.0 At1g72570.1 68414.m08392 ovule development protein, putative sim... 26 4.0 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 26 4.0 At1g26150.1 68414.m03192 protein kinase family protein similar t... 26 4.0 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 26 4.0 At1g10620.1 68414.m01204 protein kinase family protein contains ... 26 4.0 At5g64640.1 68418.m08124 pectinesterase family protein contains ... 25 5.3 At5g61800.1 68418.m07755 pentatricopeptide (PPR) repeat-containi... 25 5.3 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 25 5.3 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 25 5.3 At5g22110.1 68418.m02574 DNA polymerase epsilon subunit B family... 25 5.3 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 25 5.3 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 25 5.3 At5g04170.1 68418.m00405 calcium-binding EF hand family protein ... 25 5.3 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 25 5.3 At4g20330.1 68417.m02968 transcription initiation factor-related... 25 5.3 At3g60500.2 68416.m06767 3' exoribonuclease family protein simil... 25 5.3 At3g60500.1 68416.m06766 3' exoribonuclease family protein simil... 25 5.3 At3g28790.1 68416.m03593 expressed protein 25 5.3 At2g48160.1 68415.m06031 PWWP domain-containing protein 25 5.3 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 25 5.3 At5g64960.1 68418.m08171 cyclin-dependent kinase, putative / CDK... 25 7.0 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 25 7.0 At5g38560.1 68418.m04662 protein kinase family protein contains ... 25 7.0 At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / ... 25 7.0 At4g18400.1 68417.m02731 expressed protein 25 7.0 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 25 7.0 At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 25 7.0 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 25 7.0 At3g49060.1 68416.m05360 protein kinase family protein / U-box d... 25 7.0 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 25 7.0 At2g12610.1 68415.m01363 expressed protein ; expression supporte... 25 7.0 At2g01940.1 68415.m00129 zinc finger (C2H2 type) family protein ... 25 7.0 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 25 7.0 At1g32290.1 68414.m03975 hypothetical protein 25 7.0 At1g27040.2 68414.m03296 nitrate transporter, putative contains ... 25 7.0 At1g27040.1 68414.m03297 nitrate transporter, putative contains ... 25 7.0 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 25 7.0 At4g32340.1 68417.m04603 expressed protein 25 9.3 At4g01985.1 68417.m00265 expressed protein 25 9.3 At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family... 25 9.3 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 25 9.3 At3g18770.1 68416.m02382 expressed protein 25 9.3 At3g07660.1 68416.m00918 expressed protein 25 9.3 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 25 9.3 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 25 9.3 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 25 9.3 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 25 9.3 At1g49950.3 68414.m05604 DNA-binding protein, putative contains ... 25 9.3 At1g49950.2 68414.m05603 DNA-binding protein, putative contains ... 25 9.3 At1g49950.1 68414.m05602 DNA-binding protein, putative contains ... 25 9.3 At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative ... 25 9.3 At1g24290.1 68414.m03065 AAA-type ATPase family protein similar ... 25 9.3 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 25 9.3 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 41.5 bits (93), Expect = 8e-05 Identities = 28/61 (45%), Positives = 31/61 (50%), Gaps = 6/61 (9%) Frame = -3 Query: 180 SLPGASGAHHHLSSLPS-TGTLQRAPPLLAPTAGSRRAHRPPP---RTPCGNR--APPST 19 S P A+ HHH S P+ T R PPL A TAG R RPP T G+R PPS Sbjct: 25 SPPPATTGHHHRSPPPAITACHHRRPPLPATTAGHHRQLRPPSIPVTTNTGHRHCRPPSN 84 Query: 18 P 16 P Sbjct: 85 P 85 Score = 33.1 bits (72), Expect = 0.026 Identities = 21/57 (36%), Positives = 24/57 (42%), Gaps = 6/57 (10%) Frame = -3 Query: 165 SGAHHHLSSLPSTGTLQRAPPLLAP-----TAGSRRAHRPPPRTPCGNRAPPS-TPP 13 +G HHH S P PP + P TAG R PP P PP+ TPP Sbjct: 111 TGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 32.7 bits (71), Expect = 0.035 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +R PP LA TAG R PP T +R+PP P +C Sbjct: 9 KRQPPPLATTAGHHRRSPPPATTGHHHRSPP--PAITAC 45 Score = 30.7 bits (66), Expect = 0.14 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 165 SGAHHHLSSLPSTGTLQRAPPLLAP----TAGSRRAHRPPPRTP 46 +G HHH S P PP + P T HRPPP P Sbjct: 142 AGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 27.1 bits (57), Expect = 1.7 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 165 SGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHR--PPPRTPCGNRAPPSTPP 13 + HH L P PPL A T HR PPP P P TPP Sbjct: 89 NSGHHQLRPPPPP-----PPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPP 136 Score = 25.4 bits (53), Expect = 5.3 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -1 Query: 158 PTTISHRCRVP---VHCSEHLRFSLPRQGAGEHTGRRRGHRAVTAHRPQRH 15 P T H R P + H R LP AG H R VT + RH Sbjct: 28 PATTGHHHRSPPPAITACHHRRPPLPATTAGHHRQLRPPSIPVTTNTGHRH 78 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 34.7 bits (76), Expect = 0.009 Identities = 20/41 (48%), Positives = 22/41 (53%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P GT APP P G++ A PPP P NRA PS PP Sbjct: 541 PPPGTAA-APPPPPPPPGTQAAPPPPPPPPMQNRA-PSPPP 579 Score = 32.3 bits (70), Expect = 0.046 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 APP P G+ A PPP P APP PP Sbjct: 535 APPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 31.1 bits (67), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP P GS PPP P APP PP Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPP 528 Score = 30.3 bits (65), Expect = 0.19 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PG A P PP+ +GS PPP P N A P PP Sbjct: 556 PGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPP 609 Score = 28.7 bits (61), Expect = 0.57 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P T APP P + A PPP P APP PP Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 27.5 bits (58), Expect = 1.3 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNR---APPSTPP 13 P GT APP P RA PPP P GN PP PP Sbjct: 554 PPPGTQ-AAPPPPPPPPMQNRAPSPPP-MPMGNSGSGGPPPPPP 595 Score = 25.8 bits (54), Expect = 4.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP P + A PPP P APP PP Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPP 541 Score = 24.6 bits (51), Expect = 9.3 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRT-----PCGNRAPPSTPP 13 PP L P + PPP T P APP PP Sbjct: 477 PPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPP 513 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP +A G+ PPPR N A PP Sbjct: 609 PPPMAMANGAAGPPPPPPRMGMANGAAGPPPP 640 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.9 bits (69), Expect = 0.061 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = -3 Query: 180 SLPGASGAHHHLSSLPSTGTLQRA----PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 SL SGA+ + P L R PP P RRA PPP RAPP PP Sbjct: 2 SLVDISGAYSLVPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPP 61 Score = 29.9 bits (64), Expect = 0.25 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 117 QRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 +RAPP P RRA PPP P P S PP C Sbjct: 40 RRAPPPPPPPLMRRRAPPPPPPPPLPR--PCSRPPKTKC 76 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 31.5 bits (68), Expect = 0.081 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -3 Query: 126 GTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 GT+ PPL P RR PPP+ P PP PP Sbjct: 5 GTIPPPPPL-PPRLELRRQRAPPPQPPPPPPPPPPPPP 41 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 31.5 bits (68), Expect = 0.081 Identities = 17/55 (30%), Positives = 21/55 (38%) Frame = -3 Query: 177 LPGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +PG + P T APP AP + + PPP P PP PP Sbjct: 349 MPGNAALSASTPLTPGQFTTANAPP--APPGPANQTSPPPPPPPSAAAPPPPPPP 401 Score = 25.4 bits (53), Expect = 5.3 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P G + S P APP P A PPP PP PP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 25.4 bits (53), Expect = 5.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 APP P ++ PPP P + PP P Sbjct: 407 APP--PPPPPGKKGAGPPPPPPMSKKGPPKPP 436 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.1 bits (67), Expect = 0.11 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 SS + G RAP A A R RP P P RA P PP Sbjct: 512 SSRSARGAGSRAPSSSAKRASGSRGRRPRPPLPPPARARPLPPP 555 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 31.1 bits (67), Expect = 0.11 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPC 10 PST + +PP PT S +H P P TP + P TPPC Sbjct: 67 PSTPS-HPSPPSHTPTP-STPSHTPTPHTP-SHTPTPHTPPC 105 Score = 25.8 bits (54), Expect = 4.0 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTP-CGNRAPPSTPPCAS 4 P + T + P PT + +H P P TP C +PPS P S Sbjct: 75 PPSHTPTPSTPSHTPTPHTP-SHTPTPHTPPCNCGSPPSHPSTPS 118 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 31.1 bits (67), Expect = 0.11 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPC 10 PST + +PP PT S +H P P TP + P TPPC Sbjct: 67 PSTPS-HPSPPSHTPTP-STPSHTPTPHTP-SHTPTPHTPPC 105 Score = 25.8 bits (54), Expect = 4.0 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTP-CGNRAPPSTPPCAS 4 P + T + P PT + +H P P TP C +PPS P S Sbjct: 75 PPSHTPTPSTPSHTPTPHTP-SHTPTPHTPPCNCGSPPSHPSTPS 118 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.7 bits (66), Expect = 0.14 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -3 Query: 138 LPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 +PS+ R PP AP GS PPP P G R PP Sbjct: 379 MPSSAGPPRPPPP-APPPGSGGPKPPPPPGPKGPRPPP 415 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -3 Query: 108 PPLLAPTAGSRRA--HRPPPRTPCGNRAPPSTPP 13 PP+ AP S PPP P G+ P PP Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPP 405 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.7 bits (66), Expect = 0.14 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -3 Query: 138 LPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 +PS+ R PP AP GS PPP P G R PP Sbjct: 379 MPSSAGPPRPPPP-APPPGSGGPKPPPPPGPKGPRPPP 415 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -3 Query: 108 PPLLAPTAGSRRA--HRPPPRTPCGNRAPPSTPP 13 PP+ AP S PPP P G+ P PP Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPP 405 >At5g01840.1 68418.m00103 ovate family protein 59% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 270 Score = 30.7 bits (66), Expect = 0.14 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 150 HLSSLP-STGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +L S P ST + ++ + PT+ + + RPP R ++APPS PP Sbjct: 31 NLQSQPNSTTSKKKHHAVPTPTSTTPLSPRPPRRPSHSSKAPPSHPP 77 Score = 26.6 bits (56), Expect = 2.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -3 Query: 156 HHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNR 34 HH + + ST L PP P+ S+ PPR GNR Sbjct: 45 HHAVPTPTSTTPLSPRPPR-RPSHSSKAPPSHPPRKSSGNR 84 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.3 bits (65), Expect = 0.19 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = +2 Query: 11 HGGVEGGARLPHGVRGGGLCARRLPAVGARSGGARCSVPVL 133 HGG GG PHG +GGG P G GG S PV+ Sbjct: 57 HGGKGGGKPPPHGGKGGG-----PPHHGGGGGGGGKSPPVV 92 Score = 25.8 bits (54), Expect = 4.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 114 RAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 R PP+ P PP TP G P +TPP Sbjct: 118 RPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPP 151 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP+ P + PP TP G P +TPP Sbjct: 130 PPIQPPPVTTPPGLLPPITTPPGLLPPVTTPP 161 Score = 25.4 bits (53), Expect = 5.3 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP L P + PP TP G P +TPP Sbjct: 140 PPGLLPPITTPPGLLPPVTTPPGLLPPVTTPP 171 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 30.3 bits (65), Expect = 0.19 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 126 GTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPC 10 G PP +P A PPP P PPS PPC Sbjct: 41 GNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPC 79 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 29.9 bits (64), Expect = 0.25 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 5 DAHGGVEGGARLPHGVRGGGLCARRLPAVGARSGGA 112 D GG GG P G GGG A G SGGA Sbjct: 132 DKPGGASGGGDKPGGASGGGPGGASGGASGGASGGA 167 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 29.9 bits (64), Expect = 0.25 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -3 Query: 114 RAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 + P P + + H PP TPC P TPP Sbjct: 140 KPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP P + + +PPP TP PP+T P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTP----KPPTTKP 146 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.5 bits (63), Expect = 0.33 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -3 Query: 147 LSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +S++ S+ APP L + S PP P G PS PP Sbjct: 747 ISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPP 791 >At1g67930.1 68414.m07757 Golgi transport complex protein-related similar to golgi transport complex protein (GTC90) GB:5453670 [Homo sapiens] (stimulates in vitro Golgi transport J. Biol. Chem. 273 (45), 29565-29576 (1998)) Length = 832 Score = 29.5 bits (63), Expect = 0.33 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 S PS+ +LQR P S + PPP+TP + + P Sbjct: 7 SPSPSSPSLQRLSTFKNPPPSSLSSGAPPPQTPSSSSSSP 46 >At1g01730.1 68414.m00092 expressed protein Length = 224 Score = 29.5 bits (63), Expect = 0.33 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 132 STGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPST 19 +T +L P L +A R A P P P APPST Sbjct: 18 ATSSLPAQAPPLPTSADQRSAELPSPAQPAQMTAPPST 55 >At5g42635.1 68418.m05190 glycine-rich protein Length = 118 Score = 28.3 bits (60), Expect = 0.75 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 92 GARSGGARCSVPVLGSDERWWWAPLA 169 G GG R +V +G D WW+ LA Sbjct: 56 GGGGGGRRVTVTGVGGDRNRWWSELA 81 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 86 AVGARSGGARCSVPVLGSDERWWWAPLA 169 +VG R GG V G RWWW +A Sbjct: 24 SVGDRCGGCYV-VAGGGGGRRWWWPAVA 50 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.3 bits (60), Expect = 0.75 Identities = 17/55 (30%), Positives = 21/55 (38%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPC 10 P +++ S P PP PT PPP TP + P S PPC Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPP---PTPTYHYISPPPPPTPIHSPPPQSHPPC 753 Score = 26.6 bits (56), Expect = 2.3 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 7/63 (11%) Frame = -3 Query: 180 SLPGASGAHHHLSSLPSTGTLQRAPPL-------LAPTAGSRRAHRPPPRTPCGNRAPPS 22 SLP + +H++S P + PP +P + PPP + +PP Sbjct: 722 SLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPP 781 Query: 21 TPP 13 +PP Sbjct: 782 SPP 784 Score = 26.2 bits (55), Expect = 3.0 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRA-HRPPPRTPCGNRAPPSTPP 13 P G+ S PS +PP + GS + P P +P + PSTPP Sbjct: 514 PSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPP 568 Score = 25.8 bits (54), Expect = 4.0 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPP-PRTPCGNRAPPSTP 16 PG S + P + T P +PT + P P TP +PPS+P Sbjct: 445 PGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSP 498 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P + ++ +PP+ P+ + + P +P +PPST P Sbjct: 423 PPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTP 463 Score = 25.0 bits (52), Expect = 7.0 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPP-PRTPCGNRAPPSTPPCAS 4 P+T T +PP +PT + P P TP +PPS+P S Sbjct: 472 PTTPTPGGSPPS-SPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPS 515 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.3 bits (60), Expect = 0.75 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 SS P T T PP +P+ S PPP +P PP +PP Sbjct: 32 SSPPPTTTPSSPPP--SPSTNSTS---PPPSSPLPPSLPPPSPP 70 Score = 26.6 bits (56), Expect = 2.3 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPP-PRTPCGNRAPPS 22 PPL P+ + PP P TP R+PPS Sbjct: 75 PPLPQPSPSAPITPSPPSPTTPSNPRSPPS 104 Score = 25.8 bits (54), Expect = 4.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPP 13 PPP+ P R PP PP Sbjct: 217 PPPKPPSPPRKPPPPPP 233 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = -3 Query: 141 SLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 S P+ T PP + + PPP + +PP + P Sbjct: 17 SPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSP 59 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 28.3 bits (60), Expect = 0.75 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPP-------RTPCGNRAPPSTPP 13 PP T R+A PPP R P APP PP Sbjct: 625 PPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 28.3 bits (60), Expect = 0.75 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNR--APPSTPP 13 PST PP A + + + PPP P R APP PP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPP 719 Score = 28.3 bits (60), Expect = 0.75 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 APP L P++ A PPP P P PP Sbjct: 700 APPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 27.5 bits (58), Expect = 1.3 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 135 PSTGTLQRAP-PLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P L + P P P G + PPP G+ APP PP Sbjct: 728 PPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 27.1 bits (57), Expect = 1.7 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 PS PP + G++R +PPP P PP+ P A C Sbjct: 615 PSAPPPPPPPPPSFGSTGNKRQAQPPPPPP---PPPPTRIPAAKC 656 Score = 24.6 bits (51), Expect = 9.3 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 138 LPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 LP + T APP P S+ PPP P P PP Sbjct: 704 LPPSSTRLGAPPPPPPPPLSKTPAPPPP--PLSKTPVPPPPP 743 >At3g12990.1 68416.m01618 3' exoribonuclease family protein similar to SP|Q06265 Exosome complex exonuclease RRP45 [Homo sapiens]; contains Pfam profiles PF01138: 3' exoribonuclease family, domain 1, PF03725: 3' exoribonuclease family, domain 2 Length = 307 Score = 27.9 bits (59), Expect = 0.99 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 24 RAVRGYRTVSAAAACVLAGSLPW 92 RA+R R V + CVLAG L W Sbjct: 113 RALRESRAVDTESLCVLAGKLVW 135 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 27.5 bits (58), Expect = 1.3 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGS-RRAHRPPPRTPCGNRAPPSTPP 13 P T+ R+PP P A + + PPP G PP PP Sbjct: 170 PPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPP 211 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 27.5 bits (58), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PP P RRA PPP P R P PP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP 57 Score = 26.6 bits (56), Expect = 2.3 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 141 SLPSTGTLQRAPPLLAPTAGSRRAHR--PPPRTPCGNRAPPSTPP 13 S P G + PP P RR PPP P RAP PP Sbjct: 14 SPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 25.0 bits (52), Expect = 7.0 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = -3 Query: 117 QRAP-PLLAPTAGSRRAHRPPPRTPCGNR----APPSTPP 13 +RAP P P RRA PPP P R PP PP Sbjct: 36 RRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 27.5 bits (58), Expect = 1.3 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 120 LQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 ++ A P+LA A S PP TP +PPSTP S Sbjct: 112 MKLAVPVLA-AAPSPSTPSSPPSTPSTPSSPPSTPSTPS 149 Score = 27.1 bits (57), Expect = 1.7 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPST-PPCAS 4 SS PST + +PP T S P P +P PPS+ PP AS Sbjct: 129 SSPPSTPSTPSSPPSTPSTPSSP----PSPPSPPSPSLPPSSLPPSAS 172 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 27.5 bits (58), Expect = 1.3 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 S P G PP P+ S PPP+ P G PPS+ P Sbjct: 18 SHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQ-PYGGYPPPSSRP 60 >At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 190 Score = 26.6 bits (56), Expect = 2.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 5 DAHGGVEGGARLPHGVRGGGLCARRLPAVGARS 103 D GG GG P G GGG AVG R+ Sbjct: 132 DKPGGASGGGDKPGGASGGGPGGASGGAVGRRT 164 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 26.6 bits (56), Expect = 2.3 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -3 Query: 108 PPLLAPTAGSRR--AHRPPPRTPCGNRAPPSTPPCA 7 PP+ +P + PPPR P N P +PP A Sbjct: 623 PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPA 658 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 26.6 bits (56), Expect = 2.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPC 10 PP + + PPP PC PP PPC Sbjct: 594 PPTPVSSPPPTPVYSPPPPPPC--IEPPPPPPC 624 Score = 26.2 bits (55), Expect = 3.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPP 13 PPP PC +PP PP Sbjct: 618 PPPPPPCIEYSPPPPPP 634 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -3 Query: 150 HLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPS 22 H SS P +PP P+ + PPP PC PP+ Sbjct: 668 HYSSPPPPEVHYHSPP---PSPVHYSSPPPPPSAPCEESPPPA 707 Score = 24.6 bits (51), Expect = 9.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 123 TLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 TL PP P PPP P + PP PP Sbjct: 422 TLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPP 458 >At4g00240.1 68417.m00031 phospholipase D beta 2 / PLD beta 2 (PLDBETA2) / PLDdelta1 identical to SP|O23078 Phospholipase D beta 2 (EC 3.1.4.4) (AtPLDbeta2) (PLD beta 2) (PLDdelta1) [Arabidopsis thaliana]; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 927 Score = 26.6 bits (56), Expect = 2.3 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 P + HHH S+ +G L P ++ A H+PPP P Sbjct: 21 PYPAPPHHH-GSMSHSGPLDHHHPPMSYYASFDYQHQPPPPYP 62 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 26.6 bits (56), Expect = 2.3 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP 25 P QR P PT + PPP+T G+ +PP Sbjct: 105 PGGAPFQRFPSPPFPTTQNPPQGPPPPQTLAGHLSPP 141 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 26.6 bits (56), Expect = 2.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 120 LQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCASC 1 L R PP L P PPP P P PP ASC Sbjct: 85 LPRLPPPLLPPPEEPPREPPPPPPP-----PEEPPPPASC 119 Score = 24.6 bits (51), Expect = 9.3 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 147 LSSLP--STGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 L +LP +TGT PPL+ P PPP P +PP PP Sbjct: 16 LGNLPPGTTGTCC-PPPLVFPLL----PLSPPPSPPPSPSSPPRLPP 57 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 26.2 bits (55), Expect = 3.0 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHR--PPPR-TPCGNRAPPSTPPCAS 4 PS T PP+ P + A PPP +P +PPS+ P S Sbjct: 26 PSPTTTVTPPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPS 72 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 26.2 bits (55), Expect = 3.0 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 SSLP PPL P + PPP +P + PP PP S Sbjct: 1089 SSLPPPPPAALFPPLPPPPSQPP----PPPLSPPPSPPPPPPPPSQS 1131 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 26.2 bits (55), Expect = 3.0 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 174 PGASGAHHHLSSLPSTGTLQRAPPLL-APTAGSRRAHRPPPRTPCGNRAPPSTP 16 P ++G S P T P + AP + PPP P +PP++P Sbjct: 19 PPSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSP 72 >At3g42130.1 68416.m04326 glycine-rich protein Length = 65 Score = 26.2 bits (55), Expect = 3.0 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 5 DAHGGVEGGARLPHGVRGGGLCARRLPAVGARSGG 109 + +GG G R G R GG C + G R GG Sbjct: 30 NVYGGGGGYERHSRGYRSGGGCGGKRYGGGGREGG 64 >At3g11590.1 68416.m01416 expressed protein Length = 622 Score = 26.2 bits (55), Expect = 3.0 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 147 LSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRT 49 ++ +PS ++ A P++ + R A PPPR+ Sbjct: 108 MNEMPSPRVVEEAAPMIRKSRKERIAPLPPPRS 140 >At2g36290.1 68415.m04453 hydrolase, alpha/beta fold family protein low similarity to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus sp. RHA1] GI:8978311; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 364 Score = 26.2 bits (55), Expect = 3.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -3 Query: 168 ASGAHHHLSSLPSTGTLQRAPPLLAP--TAGSRRAHRPPPRTPCGNRAPPS 22 A+G+ + PS+G LQ+ L + + +A +PPP CG+ PS Sbjct: 2 ATGSTTDSARSPSSGVLQKLLLLFSVCIATSTYKAIQPPPSKLCGSPDGPS 52 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 PP+ +P + PP +TP N PP TP Sbjct: 664 PPVYSPPLLPPKMSSPPTQTPV-NSPPPRTP 693 Score = 25.4 bits (53), Expect = 5.3 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = -3 Query: 111 APPLLAPTAGS----RRAHRPPPRTPCGN-RAPP 25 +PPLL P S + PPPRTP APP Sbjct: 668 SPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPP 701 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 26.2 bits (55), Expect = 3.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 147 LSSLPSTGTLQRA-PPLLAPTAGSRRAHRPPPRTP 46 LSS P R+ PP P R H PPPR+P Sbjct: 88 LSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSP 122 >At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 367 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 180 SLPGASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRR 73 S+PG + AH + S ++G PP++A A S + Sbjct: 276 SIPGGTNAHSYASGPNTSGPSIGPPPVIANKAPSNQ 311 >At5g54430.1 68418.m06779 universal stress protein (USP) family protein low similarity to early nodulin ENOD18 [Vicia faba] GI:11602747, ER6 protein [Lycopersicon esculentum] GI:5669654; contains Pfam profile PF00582: universal stress protein family Length = 242 Score = 25.8 bits (54), Expect = 4.0 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 156 HHHLSSLPSTGTLQRAPPLLAPTAGSRR 73 HHH SS PS+ A P PTAG+RR Sbjct: 27 HHHSSSTPSSA----ATP--TPTAGARR 48 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 25.8 bits (54), Expect = 4.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTP 16 PPP +P G +PPS P Sbjct: 109 PPPLSPDGKGSPPSVP 124 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 25.8 bits (54), Expect = 4.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPP 13 PPP P R+PP PP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 25.8 bits (54), Expect = 4.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 Query: 84 GSRRAHRPPPRTPCGNRAPPSTPPCASC 1 G + H PPR P +PP TP C Sbjct: 298 GCKHGHGLPPRPPPPPPSPPPTPVNICC 325 >At1g72570.1 68414.m08392 ovule development protein, putative similar to ovule development protein AINTEGUMENTA (GI:1209099) [Arabidopsis thaliana];contains Pfam profile: PF00847 AP2 domain (2 copies); contains non-consensus TA acceptor splice site at exon 4 Length = 425 Score = 25.8 bits (54), Expect = 4.0 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -1 Query: 185 SNLCRVQAEPTTISHRCRVPVHCSEHLRFSLPRQGAGEHTGRRRGHRAVTAHR-PQRHRA 9 SN+ EP + + R + ++ S+PR+ + R +R VT HR R+ A Sbjct: 190 SNVSARVEEPVKVDEK-RKRLVVKPQVKESVPRKSVDSYGQRTSQYRGVTRHRWTGRYEA 248 Query: 8 H 6 H Sbjct: 249 H 249 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 25.8 bits (54), Expect = 4.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 P+ +Q P+ APT S + P P + N++P P Sbjct: 714 PNLSPVQAPTPVQAPTTSSETSQVPTPSSE-SNQSPSQAP 752 Score = 24.6 bits (51), Expect = 9.3 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 S +P+ + P APT H P P + PS+ P +S Sbjct: 735 SQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPVQSPTPSSEPVSS 781 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 25.8 bits (54), Expect = 4.0 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 S PST P P +R +PPP G++ P +PP S Sbjct: 204 SERPSTPPSDSEHPSPPPPGHPKRREQPPPP---GSKRPTPSPPSPS 247 Score = 25.4 bits (53), Expect = 5.3 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 147 LSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 +SS P + PP AP + PP P +PPS P Sbjct: 115 VSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLP 158 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P G+ + P +P+ R H PP P PP P Sbjct: 232 PPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSP 272 Score = 25.0 bits (52), Expect = 7.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPPCAS 4 PPP TP + P +PP S Sbjct: 62 PPPETPLSSPPPEPSPPSPS 81 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P T+ +PP PPP P + P S+PP Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPP 125 Score = 24.6 bits (51), Expect = 9.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 60 PPRTPCGNRAPPSTPP 13 PP TP + +PP+ PP Sbjct: 133 PPTTPITSPSPPTNPP 148 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 25.8 bits (54), Expect = 4.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 Query: 138 LPSTGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 LP GT PP P A + PPP P Sbjct: 251 LPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Score = 25.4 bits (53), Expect = 5.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 75 RAHRPPPRTPCGNRAPPSTPP 13 ++ PPP P GN A P PP Sbjct: 190 KSFAPPPPPPPGNAAIPVEPP 210 Score = 24.6 bits (51), Expect = 9.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P G PP P A R+ PP P G A P PP Sbjct: 225 PPPGRAALPPPPPLPMA-VRKGVAAPPLPPPGTAALPPPPP 264 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 25.8 bits (54), Expect = 4.0 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 72 AHRPPPRTPCGNRAPPSTPP 13 A +PPP P N PP TPP Sbjct: 65 AAQPPPNQP-PNTTPPPTPP 83 >At5g64640.1 68418.m08124 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 602 Score = 25.4 bits (53), Expect = 5.3 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = -3 Query: 81 SRRAHRPPPRTPCG-NRAPPSTPP 13 SR H P +TP + PP TPP Sbjct: 62 SRNHHNPSHQTPTSDDHPPPETPP 85 >At5g61800.1 68418.m07755 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 499 Score = 25.4 bits (53), Expect = 5.3 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 8 AHGGVEGGARLPHGVRGGGLCARRLPAVGARSGGA-RCSVPVLGSDERW 151 A G+ GG R+ + A R+ A+ GG + V + + ERW Sbjct: 424 AWSGLLGGCRIHGNIEIAEKAANRVKALSPEDGGVYKVMVEMYANAERW 472 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 25.4 bits (53), Expect = 5.3 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTA--GSRRAHRPPPRTPCGNRAPP 25 PST T PP P++ GS + PP ++ G++ PP Sbjct: 58 PSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPP 96 Score = 24.6 bits (51), Expect = 9.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPP 13 PPP TP PP +PP Sbjct: 56 PPPSTPTTACPPPPSPP 72 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 25.4 bits (53), Expect = 5.3 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGN-RAPPSTPP 13 PS + P AP+ S PPP PC +PP PP Sbjct: 384 PSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 >At5g22110.1 68418.m02574 DNA polymerase epsilon subunit B family contains Pfam profile: PF04042 DNA polymerase epsilon subunit B Length = 523 Score = 25.4 bits (53), Expect = 5.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 164 AEPTTISHRCRVPVHCSEHLRFSLP 90 A P+T+ RC +P + +E LR +P Sbjct: 368 AGPSTVLPRCALPKYLTEELRNIIP 392 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 25.4 bits (53), Expect = 5.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P+T +Q +PP+ PT + PP T + P +TPP Sbjct: 142 PTTPPVQ-SPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPP 181 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 25.4 bits (53), Expect = 5.3 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -3 Query: 135 PSTGTLQRAPPLLA---PTAGSRRAHRPPPRTPCGNRAPPSTPP 13 P+T PP +A P A A PP TP PPS P Sbjct: 34 PATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAP 77 >At5g04170.1 68418.m00405 calcium-binding EF hand family protein low similarity to peflin [Homo sapiens] GI:6015440; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 354 Score = 25.4 bits (53), Expect = 5.3 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 171 GASGAHHHLSSLPSTGTLQR-APPLLAPTAGSRRAH-RPPPRTPCGN--RAPP 25 GAS SS P+ G+ APP AP A S + +PP P G APP Sbjct: 51 GASKPQSSSSSAPTYGSSSYGAPPPSAPYAPSPGDYNKPPKEKPYGGGYGAPP 103 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 129 TGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 T T + P+ +P + + + PP TP +PP P S Sbjct: 58 TPTASASSPVESPKSPAPVSESSPPPTPVPESSPPVPAPMVS 99 >At4g20330.1 68417.m02968 transcription initiation factor-related contains weak similarity to Transcription initiation factor IIE, beta subunit (TFIIE-beta) (Swiss-Prot:P29084) [Homo sapiens] Length = 286 Score = 25.4 bits (53), Expect = 5.3 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 173 RVQAEPTTISHRCRVPVHCSEHLRFSLPRQGAGEHTGRRRGHRA 42 R+ P I+ C V +H ++ + SL + + GRR ++A Sbjct: 89 RLALTPEQINEWCHVDMHANKAVFDSLRKNPKAHYDGRRFSYKA 132 >At3g60500.2 68416.m06767 3' exoribonuclease family protein similar to SP|Q06265 Exosome complex exonuclease RRP45 [Homo sapiens]; contains Pfam profiles PF01138: 3' exoribonuclease family, domain 1, PF03725: 3' exoribonuclease family, domain 2 Length = 438 Score = 25.4 bits (53), Expect = 5.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 24 RAVRGYRTVSAAAACVLAGSLPW 92 R +R R V + CVLAG + W Sbjct: 113 RGLRESRAVDTESLCVLAGKMVW 135 >At3g60500.1 68416.m06766 3' exoribonuclease family protein similar to SP|Q06265 Exosome complex exonuclease RRP45 [Homo sapiens]; contains Pfam profiles PF01138: 3' exoribonuclease family, domain 1, PF03725: 3' exoribonuclease family, domain 2 Length = 438 Score = 25.4 bits (53), Expect = 5.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 24 RAVRGYRTVSAAAACVLAGSLPW 92 R +R R V + CVLAG + W Sbjct: 113 RGLRESRAVDTESLCVLAGKMVW 135 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 25.4 bits (53), Expect = 5.3 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -3 Query: 168 ASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 +SGA S P+ T P PT + P P TP + PSTP Sbjct: 270 SSGASPSGSPTPTPST----PTPSTPTPSTPTPSTPTPSTPTPSTPAPSTP 316 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 25.4 bits (53), Expect = 5.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 84 GSRRAHRPPPRTPCGNRAPPSTPP 13 GS HRP P P + PP PP Sbjct: 1220 GSNFQHRPYPSHPHPHPPPPPPPP 1243 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 25.4 bits (53), Expect = 5.3 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -3 Query: 156 HHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCAS 4 +H +P+T Q+ P ++A T + PPP P PP P S Sbjct: 77 NHTQIEIPAT-IRQQPPSVVADTEKVKVEANPPPPPPPSPSPPPPPGPVKS 126 >At5g64960.1 68418.m08171 cyclin-dependent kinase, putative / CDK, putative similar to cyclin dependent kinase C [Lycopersicon esculentum] gi|15215944|emb|CAC51391 Length = 513 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPS 22 APP P G +P P NR PPS Sbjct: 405 APPPQIPAGGHYYGGKPRGGAPVPNRYPPS 434 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 25.0 bits (52), Expect = 7.0 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPP-PRTPCGNRAPPSTPP 13 P + Q +PP + R+ PP P T C N+ PP PP Sbjct: 65 PPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQ-PPGPPP 105 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 25.0 bits (52), Expect = 7.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 +PP +P+ + PP P + +PPS+ P Sbjct: 154 SPPKPSPSTPTPTTTTSPPPPPATSASPPSSNP 186 >At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / caspase family protein contains similarity to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam profile PF00656: ICE-like protease (caspase) p20 domain Length = 418 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 96 APTAGSRRAHRPPPRTPCGNRAPPSTPP 13 AP H PP +P N APP PP Sbjct: 84 APPDSYPFTHAPPASSPF-NHAPPGPPP 110 >At4g18400.1 68417.m02731 expressed protein Length = 107 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPST 19 PPL +P S + PPP T PP+T Sbjct: 12 PPLPSPPESSSQPEHPPPET----STPPAT 37 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 25.0 bits (52), Expect = 7.0 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = -3 Query: 150 HLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 H S + + PPL P R A PPP + PP PP Sbjct: 240 HEFSTAESSSAAGLPPLKLPPG--RSAPPPPPAAAPPPQPPPPPPP 283 Score = 24.6 bits (51), Expect = 9.3 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -3 Query: 141 SLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 S S +L+R + S A PP + P G APP P A Sbjct: 228 SFLSRVSLKRNGHEFSTAESSSAAGLPPLKLPPGRSAPPPPPAAA 272 >At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family protein Length = 477 Score = 25.0 bits (52), Expect = 7.0 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -3 Query: 156 HHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPC 10 HHH L P L PT G A P +P PP PPC Sbjct: 341 HHHHHELAP------EPSLSPPTKGFAPASAPTKHSP----LPPRNPPC 379 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 25.0 bits (52), Expect = 7.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -3 Query: 168 ASGAHHHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 ++G+ +S PST + P +P + + PPP TP + +PPS P Sbjct: 66 SNGSAPAISISPST-PIPSTPSTPSPPPPAPKKSPPPP-TPKKSPSPPSLTP 115 >At3g49060.1 68416.m05360 protein kinase family protein / U-box domain-containing protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 805 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 93 EREAEVLAAVYRYSAAMRDGG 155 ERE +V V+RY AM D G Sbjct: 281 EREGDVARKVHRYDKAMHDIG 301 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 25.0 bits (52), Expect = 7.0 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 108 PPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 PP PT+ + PPP P + PPS PP A Sbjct: 64 PPPPPPTSPPPPSP-PPPSPPPPSPPPPSPPPPA 96 >At2g12610.1 68415.m01363 expressed protein ; expression supported by MPSS Length = 419 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 129 TGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 T T AP LL P R PPP+TP Sbjct: 318 TVTSPTAPSLLDPPHKRLRNSFPPPKTP 345 >At2g01940.1 68415.m00129 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 439 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 81 SRRAHRPPPRTPCGNRAPPSTPPCAS 4 +RR HR PPR P + + P C+S Sbjct: 195 ARRVHREPPRPP---QTAVTVPACSS 217 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 25.0 bits (52), Expect = 7.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 63 PPPRTPCGNRAPPSTPP 13 PPPR+P +PPS+ P Sbjct: 233 PPPRSPPPKSSPPSSLP 249 >At1g32290.1 68414.m03975 hypothetical protein Length = 80 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 92 GARSGGARCSVPVLGSDERWWWAP 163 G RS SV GSD R WW P Sbjct: 8 GGRSRWWSESVTADGSDGRCWWCP 31 >At1g27040.2 68414.m03296 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 563 Score = 25.0 bits (52), Expect = 7.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 58 RRPVCSPAPCRGSEKRRCSL 117 RRP P PC+ S RC + Sbjct: 117 RRPSLMPPPCKSSAALRCEV 136 >At1g27040.1 68414.m03297 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 567 Score = 25.0 bits (52), Expect = 7.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 58 RRPVCSPAPCRGSEKRRCSL 117 RRP P PC+ S RC + Sbjct: 121 RRPSLMPPPCKSSAALRCEV 140 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 25.0 bits (52), Expect = 7.0 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -3 Query: 135 PSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPP---STPP 13 PS PP + + S RA+ PPP P + PP S+PP Sbjct: 434 PSVRAYSPPPPPYSKMSPSVRAY-PPPPPPSPSPPPPYVYSSPP 476 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 24.6 bits (51), Expect = 9.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 29 GARLPHGVRGGGLCARRLPAVGARSGGARCSV 124 G+RLP G GG R G GG SV Sbjct: 79 GSRLPQGGSNGGFGGRGGDGAGGGGGGGGGSV 110 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 24.6 bits (51), Expect = 9.3 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +2 Query: 8 AHGGVEGGARLPHGVRGGGLCARRLPAVGARSGGARCSV 124 A GGV GG + G GGG VGA GGA SV Sbjct: 152 ASGGVGGGGKGRGGKSGGGAGGGVGGGVGA-GGGAGGSV 189 >At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family protein identical to hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|9293881|dbj|BAB01784 Length = 532 Score = 24.6 bits (51), Expect = 9.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 105 PLLAPTAGSRRAHRPPPRTPCGNRAPP 25 P +P S A+ PP T NR+PP Sbjct: 451 PSHSPQYASPAAYPSPPTTVYSNRSPP 477 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 24.6 bits (51), Expect = 9.3 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -3 Query: 141 SLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 S+PS T +PP PT P P P + PP +PP Sbjct: 143 SVPSP-TPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPP 184 >At3g18770.1 68416.m02382 expressed protein Length = 625 Score = 24.6 bits (51), Expect = 9.3 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -3 Query: 153 HHLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTP 16 H L S P + L P + PT G R+ P +PC + +PP +P Sbjct: 336 HALVSHPCSRHLPPHPSDI-PT-GRRKESYPEEYSPCQDFSPPPSP 379 >At3g07660.1 68416.m00918 expressed protein Length = 841 Score = 24.6 bits (51), Expect = 9.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 SS+P T Q+ P+ P G +H PP P G +P PP Sbjct: 606 SSIPVT---QQPVPVFRPP-GLHMSHYPPNYVPYGYFSPFYLPP 645 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 24.6 bits (51), Expect = 9.3 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -3 Query: 114 RAPPLL--APTAGSRRAHRPPPRTPCGNRAPPSTP 16 R+PP +PT G RR++ P R+P R +P Sbjct: 128 RSPPRYRKSPTYGGRRSYSPRARSPPPPRRRSPSP 162 >At2g23770.1 68415.m02839 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains Pfam domains, PF00069: Protein kinase domain and PF01476: LysM domain Length = 612 Score = 24.6 bits (51), Expect = 9.3 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 105 PLLAPTAGSRRAHRPPPRTPCGNRAPPSTPP 13 PL+ P A + PPP P + +PP P Sbjct: 232 PLVNPPANTNSLIPPPPPPPPQSVSPPPLSP 262 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 24.6 bits (51), Expect = 9.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 69 HRPPPRTPCGNRAPPSTPP 13 H+PPP+ PP PP Sbjct: 225 HQPPPQVKQSEPTPPPPPP 243 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAPPSTPPCA 7 AP + P A PP TP P++PP A Sbjct: 108 APTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPA 142 >At1g49950.3 68414.m05604 DNA-binding protein, putative contains similarity to DNA-binding protein PcMYB1 [Petroselinum crispum] gi|2224899|gb|AAB61699 Length = 300 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 +SL T +LQ + T+G + + PPPR P Sbjct: 85 NSLALTNSLQSDEENVDATSGLQVSSNPPPRRP 117 >At1g49950.2 68414.m05603 DNA-binding protein, putative contains similarity to DNA-binding protein PcMYB1 [Petroselinum crispum] gi|2224899|gb|AAB61699 Length = 300 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 +SL T +LQ + T+G + + PPPR P Sbjct: 85 NSLALTNSLQSDEENVDATSGLQVSSNPPPRRP 117 >At1g49950.1 68414.m05602 DNA-binding protein, putative contains similarity to DNA-binding protein PcMYB1 [Petroselinum crispum] gi|2224899|gb|AAB61699 Length = 300 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 144 SSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRTP 46 +SL T +LQ + T+G + + PPPR P Sbjct: 85 NSLALTNSLQSDEENVDATSGLQVSSNPPPRRP 117 >At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative similar to GTL1 [Arabidopsis thaliana] GI:2664198 Length = 669 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 150 HLSSLPSTGTLQRAPPLLAPTAGSRRAHRPPPRT 49 H LP + + Q PP P A ++R PP T Sbjct: 345 HTIQLPPSLSSQPPPPYQPPPAVTKRVAEPPLST 378 >At1g24290.1 68414.m03065 AAA-type ATPase family protein similar to Werner helicase interacting protein [Homo sapiens] GI:14349166; contains Pfam profiles PF00004: ATPase family associated with various cellular activities (AAA), PF00627: UBA/TS-N domain; contains ATP/GTP-binding site motif A (P-loop) Length = 525 Score = 24.6 bits (51), Expect = 9.3 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = -3 Query: 150 HLSSLPSTGTLQRA--------PPLLAPTAGSRRAHRPPPRT 49 H SS ST TLQ P LAP G + RP P+T Sbjct: 36 HRSSPQSTATLQPKLDRFLRLHPKALAPAMGDDSSKRPNPKT 77 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 24.6 bits (51), Expect = 9.3 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -3 Query: 111 APPLLAPTAGSRRAHRPPPRTPCGNRAP---PSTPPCAS 4 +P +AP S + PP +PC + P P PP S Sbjct: 9 SPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPS 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,023,357 Number of Sequences: 28952 Number of extensions: 111930 Number of successful extensions: 973 Number of sequences better than 10.0: 99 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 12,070,560 effective HSP length: 42 effective length of database: 10,854,576 effective search space used: 217091520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -