Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_F19
         (367 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g71400.1 68414.m08246 disease resistance family protein / LRR...    26   8.8  

>At1g71400.1 68414.m08246 disease resistance family protein / LRR
           family protein contains leucine rich-repeat domains
           Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D
           [Lycopersicon esculentum] gi|3894393|gb|AAC78596
          Length = 847

 Score = 25.8 bits (54), Expect = 8.8
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = -1

Query: 121 VLVISQSSITLIF*TEKS*RHNIQYFQNVLNLFS 20
           + V+S ++ T  F  + S  HN++YF    N FS
Sbjct: 282 IFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFS 315


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,650,378
Number of Sequences: 28952
Number of extensions: 108165
Number of successful extensions: 191
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 191
length of database: 12,070,560
effective HSP length: 73
effective length of database: 9,957,064
effective search space used: 477939072
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)