BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F17 (322 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 21 4.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 21 4.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 20 6.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 20 8.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 20 8.4 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 20.6 bits (41), Expect = 4.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 96 DEMFSDTYKVKLIDEVI 146 +E++SD Y IDE++ Sbjct: 20 EELYSDKYDYVNIDEIL 36 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 20.6 bits (41), Expect = 4.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 96 DEMFSDTYKVKLIDEVI 146 +E++SD Y IDE++ Sbjct: 20 EELYSDKYDYVNIDEIL 36 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.2 bits (40), Expect = 6.4 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = +3 Query: 81 DVITGDEMFSDTYKVKLIDEVIYEVTGKTVIRTQDD 188 D I F D K+K I +G T +D Sbjct: 825 DAILDQNKFKDIIKIKTIGSTYMAASGITESAESED 860 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 19.8 bits (39), Expect = 8.4 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = -1 Query: 121 LYVSENISSPVITSL*IIILMDWRRFKIIK 32 LYVS I++ V + I + + W + ++++ Sbjct: 233 LYVSGFITTEVAGTYAIFLYISWHQKELVR 262 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 19.8 bits (39), Expect = 8.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 229 SASSAEGLNPSMWISSCV 176 S SS + L+P +SSCV Sbjct: 905 SESSKKVLSPGELLSSCV 922 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,622 Number of Sequences: 438 Number of extensions: 1873 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6968808 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -