BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F15 (402 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25554| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 >SB_25554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 45.6 bits (103), Expect = 2e-05 Identities = 18/36 (50%), Positives = 27/36 (75%) Frame = -2 Query: 347 LDWAAFAVMTLPSLAIPFGLWYSSKSKYEKLAKPKK 240 +DW F++M++P++ IPF +WY S SKYE + K KK Sbjct: 1 VDWGLFSLMSIPTMLIPFMVWYRSHSKYENI-KAKK 35 >SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = -2 Query: 341 WAAFAVMTLPSLAIPFGLWYSSKSKYEKLAKPKKTH*LRFVLVQSLLMFYVVFFY 177 +A V ++P+L I + +W S + + K H F ++ L+F F+ Sbjct: 359 FALLFVCSIPNLVIEYDIWESDSIMFSLFYRFKSVHVDNFHVISQELVFDAFLFF 413 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,978,203 Number of Sequences: 59808 Number of extensions: 140940 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -