BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F14 (372 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0177 + 32163393-32163443,32163711-32163803,32163875-321640... 28 2.0 06_03_0937 - 26113346-26113645,26113721-26114193,26114436-26114724 28 2.7 >03_06_0177 + 32163393-32163443,32163711-32163803,32163875-32164071, 32164157-32164262,32164391-32164537,32164637-32164756 Length = 237 Score = 28.3 bits (60), Expect = 2.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 114 PQVWIPKICWLFTKN 158 P +W+P +CWL K+ Sbjct: 59 PTIWLPVVCWLLVKS 73 >06_03_0937 - 26113346-26113645,26113721-26114193,26114436-26114724 Length = 353 Score = 27.9 bits (59), Expect = 2.7 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -2 Query: 203 QP*DTAKAAASTMNTVFSEKPTNFRNPDLGVFVSII 96 +P A AAA+ +T + ++ R PDLGV +S++ Sbjct: 81 EPVAAAAAAATVASTSVFDNESHTRTPDLGVGLSLV 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,406,891 Number of Sequences: 37544 Number of extensions: 177074 Number of successful extensions: 313 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 588739508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -