BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F14 (372 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_55290| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 >SB_6538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 927 Score = 26.6 bits (56), Expect = 6.4 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 283 HSNFLGSNYDFCTYKSGNHDRC*VCTNNRKILQRPP 176 +S+ NY C Y S + + C + ++L++PP Sbjct: 444 YSSVPNVNYSLCVYTSDSVTQVPTCPSTVEVLRKPP 479 >SB_55290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 26.2 bits (55), Expect = 8.5 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +2 Query: 68 RILGISDFILLCSQKPPSLDSENLLAFH*KLCS*LKRRPLQYLTVV 205 R LG+S +C+ +P L+ +L+F +LCS P+Q++ ++ Sbjct: 112 RSLGLSSSFQICAFRPGYLERRGILSF--RLCS-----PIQHVAIL 150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,134,558 Number of Sequences: 59808 Number of extensions: 206879 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 607387585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -