BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F10 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 25 0.33 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 25 0.33 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 4.0 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 5.4 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 5.4 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 25.0 bits (52), Expect = 0.33 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -1 Query: 99 KIIFLYFWHYKFYLNFCFSTYCKTM 25 + + L F+ Y FYL++ ++TY + + Sbjct: 78 RFLCLPFYSYFFYLSYIYTTYSRKL 102 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 25.0 bits (52), Expect = 0.33 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -1 Query: 99 KIIFLYFWHYKFYLNFCFSTYCKTM 25 + + L F+ Y FYL++ ++TY + + Sbjct: 34 RFLCLPFYSYFFYLSYIYTTYSRKL 58 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.4 bits (43), Expect = 4.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 51 KNLSKIYSAKNIEKLSFKINIMSKSEVLYMKGMNTSE 161 +NLS + + I+ L N + SEVL N S+ Sbjct: 125 RNLSSLQIGEKIQALDPSTNELVFSEVLLFLDYNPSQ 161 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 173 VSIRFRSVHAFHVKYFTLRHYINF 102 V+++ ++H F V Y L H++ + Sbjct: 164 VTLQAYTLHLFCVLYVVLLHFLTY 187 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 173 VSIRFRSVHAFHVKYFTLRHYINF 102 V+++ ++H F V Y L H++ + Sbjct: 164 VTLQAYTLHLFCVLYVVLLHFLTY 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,107 Number of Sequences: 336 Number of extensions: 1551 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -