BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F09 (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) 84 5e-17 SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 81 5e-16 SB_25925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) 28 3.8 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 28 3.8 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 27 5.0 SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) 27 5.0 SB_17985| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_50009| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) Length = 113 Score = 83.8 bits (198), Expect = 5e-17 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = +3 Query: 246 VAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGXXXXXXXXXXXXXDSLYTGAT 425 +AY+++EGD I+CAAY+HELPRYG+KVGLTNYAAAYCTG +YTG Sbjct: 1 IAYAKLEGDVIICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYTGTE 60 Query: 426 E 428 E Sbjct: 61 E 61 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 80.6 bits (190), Expect = 5e-16 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 120 RRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQ 245 RR +GKTDYYARKRL+ QDKNKYNTPKYR +VR++NKD+ CQ Sbjct: 17 RRSQGKTDYYARKRLITQDKNKYNTPKYRFVVRITNKDIICQ 58 >SB_25925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.7 bits (61), Expect = 2.2 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +1 Query: 175 IKTNTTLQSTD*LYGYPIKMLPV-KLHTHALRVITLSVLPTLMNSHAMVSRWV*LTMLLP 351 IK NT ++T L + ++ PV K H R + L TL+N+ V+ W+ +LL Sbjct: 333 IKGNTISENT--LSTFRVRNTPVSKQHDDINRALFLE--STLLNTFQNVALWLQKFLLLK 388 Query: 352 TALVC 366 A+VC Sbjct: 389 PAMVC 393 >SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 207 LIVRLSNKDVTCQVAYSRIEGD-HIVC 284 L++ LS +D+TC V YS G+ H +C Sbjct: 108 LLLYLSKRDITCPVPYSSRNGELHTMC 134 >SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1433 Score = 27.9 bits (59), Expect = 3.8 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -2 Query: 383 QSSCQQQTSAVGSSIVSQTHLD--TIAWEFMRVGSTDNVITLNA*VCNLTGNIFI 225 Q C T+ GS IV+ +D + E R+G + NV L V LTG + I Sbjct: 378 QCLCDHLTAFGGSMIVAPNPIDFNKVFLEMSRLGESGNVAVLATIVSILTGYLVI 432 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 75 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVV 170 VK+K+ KR K KR+ + K+D + RK+ ++ Sbjct: 228 VKHKRKQKRKSAKHKRKHKRKSDKHKRKQTLI 259 >SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3160 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 255 SRIEGDHIVCAAYSH-ELPRYGIKVGLTNYAAAY 353 ++ GDH+ A+YSH ++ R+ + + L AAY Sbjct: 133 AKYRGDHLDIASYSHQQIDRFAVLLDLWTNEAAY 166 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 60 GFVKVVKNKQYFKRYQVKFKRRREGKTDY 146 GF++ +K + RY VK R R DY Sbjct: 1090 GFIEALKRRDVSSRYNVKHARFRRATNDY 1118 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 213 VRLSNKDVTCQVAYSRIEGDHIVCAAY 293 VRL ++D TC +YS I + +CA Y Sbjct: 405 VRLVSRD-TCNASYSGIINERYICAGY 430 >SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) Length = 718 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 213 VRLSNKDVTCQVAYSRIEGDHIVCAAY 293 VRL ++D TC +YS I + +CA Y Sbjct: 690 VRLVSRD-TCNASYSGIINERYICAGY 715 >SB_17985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/71 (21%), Positives = 37/71 (52%) Frame = +3 Query: 69 KVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 248 K +K+ Q+ V+F+ +E + D + R + ++QD N T + ++++ N+ ++ Sbjct: 400 KTMKSMQFKNEELVRFQYNQEDQVDDFKRLKKLIQD-NGLPTIEQVIVLQRQNESYREEL 458 Query: 249 AYSRIEGDHIV 281 R E + ++ Sbjct: 459 MNERKEKERLL 469 >SB_50009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 8.7 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 6/82 (7%) Frame = +3 Query: 54 KMGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQD-KNKYNTP--KYRLIVR-- 218 ++ F K K Y + Q + + R EGK+ + +R+ + N N P K + V Sbjct: 40 RVTFGKHFKGSLYIESTQRQKEERTEGKSAKHKDERVGKRCILNGLNVPQCKNSIYVNYE 99 Query: 219 -LSNKDVTCQVAYSRIEGDHIV 281 LS K++TC + +GD ++ Sbjct: 100 LLSQKEITCPYTFPEGDGDILI 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,814,190 Number of Sequences: 59808 Number of extensions: 284163 Number of successful extensions: 716 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -