BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F08 (348 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 24 1.9 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 3.2 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 228 AIYFSNSMSHVFSICLFINLFAPIK*KTCIYP 323 AI F +FS+C F+ + A +C+ P Sbjct: 505 AIKFGLFFQPIFSVCWFLEVIALENVHSCVMP 536 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 3.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 310 VFYFMGANKLINKQIEKTWLI 248 +F F+G + NK + TW + Sbjct: 540 IFMFLGVATVNNKHVWNTWFV 560 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 361,806 Number of Sequences: 2352 Number of extensions: 6717 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24935070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -