BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F05 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 3.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.1 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.4 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 489 KFQDLVDTLSYII*FSDEVADWTMDGYRGVRDL 391 K Q L+ L + ++D W + Y GVRDL Sbjct: 66 KNQLLITNLWLKLEWNDVNMRWNVSDYGGVRDL 98 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.0 bits (42), Expect = 7.1 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 73 DSQAVIDDIVNDYNK 117 D++ + DD++++YNK Sbjct: 28 DAKRLYDDLLSNYNK 42 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.0 bits (42), Expect = 7.1 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 73 DSQAVIDDIVNDYNK 117 D++ + DD++++YNK Sbjct: 28 DAKRLYDDLLSNYNK 42 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 7.1 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 73 DSQAVIDDIVNDYNK 117 D++ + DD++++YNK Sbjct: 24 DAKRLYDDLLSNYNK 38 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 244 IPMNRIRKIPMNRIRKIPMHC 182 +P RIRK+P + P+ C Sbjct: 640 LPPKRIRKMPSMPLLPRPISC 660 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.310 0.129 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,531 Number of Sequences: 438 Number of extensions: 1814 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.3 bits)
- SilkBase 1999-2023 -