BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F04 (355 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000498D02 Cluster: hypothetical protein 198.t00017;... 30 9.9 >UniRef50_UPI0000498D02 Cluster: hypothetical protein 198.t00017; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 198.t00017 - Entamoeba histolytica HM-1:IMSS Length = 524 Score = 30.3 bits (65), Expect = 9.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -2 Query: 207 SLILYESIKIISEHHYSVIHILAWLLYSY*IGEAVMKNI 91 S +++ES I+ H +I+++ W+ Y IG+ K+I Sbjct: 411 STLMFESEDFIASHKQYIINLVHWIFYRMIIGKNATKDI 449 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 283,717,012 Number of Sequences: 1657284 Number of extensions: 4574997 Number of successful extensions: 6875 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6875 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 11514999177 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -