BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F04 (355 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060329-1|AAL25368.1| 654|Drosophila melanogaster GH21837p pro... 27 9.1 AE013599-922|AAF58902.2| 654|Drosophila melanogaster CG1698-PA ... 27 9.1 >AY060329-1|AAL25368.1| 654|Drosophila melanogaster GH21837p protein. Length = 654 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = -2 Query: 207 SLILYESIKIISEHHYSVIHILAWLLYSY*IGEAV 103 +L+LYE +K + S +++ W L ++ +G+ + Sbjct: 551 TLVLYEPLKYKDYTYQSGVYVFGWCLSAFGVGQVL 585 >AE013599-922|AAF58902.2| 654|Drosophila melanogaster CG1698-PA protein. Length = 654 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = -2 Query: 207 SLILYESIKIISEHHYSVIHILAWLLYSY*IGEAV 103 +L+LYE +K + S +++ W L ++ +G+ + Sbjct: 551 TLVLYEPLKYKDYTYQSGVYVFGWCLSAFGVGQVL 585 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,342,285 Number of Sequences: 53049 Number of extensions: 196157 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 859222404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -