BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F03 (396 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT004866-1|AAO45222.1| 1128|Drosophila melanogaster LD43531p pro... 28 5.2 AF129433-1|AAD21090.1| 883|Drosophila melanogaster histone deac... 28 5.2 AE014298-2131|AAN09662.1| 1138|Drosophila melanogaster CG6170-PC... 28 5.2 AE014298-2130|AAN09661.1| 1135|Drosophila melanogaster CG6170-PB... 28 5.2 AE014298-2129|AAF48443.2| 1128|Drosophila melanogaster CG6170-PA... 28 5.2 >BT004866-1|AAO45222.1| 1128|Drosophila melanogaster LD43531p protein. Length = 1128 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 143 NTTRLSVRGRDAGVCVPRWRLCYHYKRQLLFN 48 N RL V + + VP +++CY Y Q+L + Sbjct: 514 NAARLQVLRAETKLSVPSFKVCYAYDAQMLLH 545 >AF129433-1|AAD21090.1| 883|Drosophila melanogaster histone deacetylase HDA2 protein. Length = 883 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 143 NTTRLSVRGRDAGVCVPRWRLCYHYKRQLLFN 48 N RL V + + VP +++CY Y Q+L + Sbjct: 439 NAARLQVLRAETKLSVPSFKVCYAYDAQMLLH 470 >AE014298-2131|AAN09662.1| 1138|Drosophila melanogaster CG6170-PC, isoform C protein. Length = 1138 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 143 NTTRLSVRGRDAGVCVPRWRLCYHYKRQLLFN 48 N RL V + + VP +++CY Y Q+L + Sbjct: 524 NAARLQVLRAETKLSVPSFKVCYAYDAQMLLH 555 >AE014298-2130|AAN09661.1| 1135|Drosophila melanogaster CG6170-PB, isoform B protein. Length = 1135 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 143 NTTRLSVRGRDAGVCVPRWRLCYHYKRQLLFN 48 N RL V + + VP +++CY Y Q+L + Sbjct: 521 NAARLQVLRAETKLSVPSFKVCYAYDAQMLLH 552 >AE014298-2129|AAF48443.2| 1128|Drosophila melanogaster CG6170-PA, isoform A protein. Length = 1128 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 143 NTTRLSVRGRDAGVCVPRWRLCYHYKRQLLFN 48 N RL V + + VP +++CY Y Q+L + Sbjct: 514 NAARLQVLRAETKLSVPSFKVCYAYDAQMLLH 545 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,961,611 Number of Sequences: 53049 Number of extensions: 221081 Number of successful extensions: 317 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1128794130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -