BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_F02 (249 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 2.3 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 20 4.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 20 4.0 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 20 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 19 9.3 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 2.3 Identities = 11/39 (28%), Positives = 14/39 (35%) Frame = -2 Query: 212 SRVHHPDAAARLRLRRTPGLHRHHAQLRYTQRSLPSALE 96 S VH R HH +TQ + +ALE Sbjct: 383 SSVHSDSGENNSRGHSGQSSSHHHGSKSWTQEDMDAALE 421 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 20.2 bits (40), Expect = 4.0 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 212 SRVHHPDAAARLRLRRTPGLHRHHAQLRY 126 S V PD+A R+ GLH A R+ Sbjct: 389 SIVSSPDSARHQRIGGCNGLHTTTAHNRF 417 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 20.2 bits (40), Expect = 4.0 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 192 IWMVDSRWLIVKNRPEG 242 +W+V + L N PEG Sbjct: 259 VWIVTEQALDASNAPEG 275 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 19.8 bits (39), Expect = 5.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 200 HPDAAARLRLRRTP 159 +PD +RLRR P Sbjct: 200 YPDITYEIRLRRRP 213 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 19.0 bits (37), Expect = 9.3 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = -2 Query: 212 SRVHHPDAAARLRLRRTPGLHRHHAQLRYTQ 120 S++HH ++ G H+ AQ ++ Q Sbjct: 166 SQMHHQMHTQHPHMQPQQGQHQSQAQQQHLQ 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,420 Number of Sequences: 438 Number of extensions: 544 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 47 effective length of database: 125,757 effective search space used: 4401495 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -