BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E24 (532 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 3.9 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 6.8 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 6.8 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 6.8 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 8.9 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 3.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 304 PLILATQKQFNFTHILAPAT 363 P L Q+ FN +LAP+T Sbjct: 239 PTPLVPQQGFNMERLLAPST 258 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.0 bits (42), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -1 Query: 139 FGWLVTIPHYYVLLRPTCFVNAAAVQSKIDAYCLVKTYFNVFFSLV 2 FGW + Y L+ +++ A + D Y +V +F+ V Sbjct: 225 FGWQILFLITYATLQILVYLHLAVMLGFQDIYMIVYIIVVIFWYTV 270 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -1 Query: 139 FGWLVTIPHYYVLLRPTCFVNAAAVQSKIDAYCLVKTYFNVFFSLV 2 FGW + Y L+ +++ A + D Y +V +F+ V Sbjct: 225 FGWQILFLITYATLQILVYLHLAVMLGFQDIYMIVYIIVVIFWYTV 270 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 206 PHFVPTTSTDISPP 165 P +PT ST SPP Sbjct: 221 PTGIPTPSTSASPP 234 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 353 AKIWVKLNCFCV 318 AK WV L FC+ Sbjct: 3 AKFWVNLALFCL 14 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,128 Number of Sequences: 336 Number of extensions: 2241 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -