BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E21 (337 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 51 1e-08 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 2.3 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 22 5.4 AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding pr... 22 7.1 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 21 9.4 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 50.8 bits (116), Expect = 1e-08 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +2 Query: 233 DVGSCIKADKDKFQVNLDVQHFTPEEISVKTAD 331 D GS + KDKFQ+NLDVQ F+PEEISVK D Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVD 35 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 53 NLKMSLLPFLFDYEIERPRRLLDQHFGLAITPEDLLN 163 +L +LLP +++ E E+ + L +AIT + N Sbjct: 149 SLSNALLPSVYNQEFEKAKEKLSTAKAIAITSDGWTN 185 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 86 DYEIERPRRLLDQHFGLAITPE 151 D E RP R LD+H LA+ + Sbjct: 109 DPERFRPERFLDEHGRLALAKD 130 >AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding protein AgamOBP8 protein. Length = 176 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 164 HSANLQE*WPIRNADLEDDEDARSRNQK 81 H AN+ NA +ED +D RS + Sbjct: 117 HEANVHAQMQHSNAIVEDPDDIRSETSR 144 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 250 DTGTDVSGGGGE 215 DTGT V GGG+ Sbjct: 594 DTGTTVPAGGGK 605 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 305,455 Number of Sequences: 2352 Number of extensions: 4837 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 23774685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -