Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_E18
         (423 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    24   0.70 
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      21   4.9  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 23.8 bits (49), Expect = 0.70
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 148  RPPSTTRQWQ 119
            RPPSTT  WQ
Sbjct: 1175 RPPSTTNHWQ 1184


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 21.0 bits (42), Expect = 4.9
 Identities = 10/45 (22%), Positives = 18/45 (40%)
 Frame = -3

Query: 307 ITQMAKGRVSLFVNRCMFSSSYETGVELLLRSSRQVVAEIEPVPH 173
           +T+     + L  +      SY +   +       V  ++EPVPH
Sbjct: 37  LTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHSPVFGKVEPVPH 81


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,953
Number of Sequences: 336
Number of extensions: 1384
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  9384961
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)