BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E18 (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 0.86 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 3.5 AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 ... 23 4.6 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 6.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 6.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 22 8.0 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 22 8.0 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 22 8.0 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 22 8.0 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 22 8.0 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 22 8.0 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 22 8.0 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 22 8.0 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 22 8.0 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 22 8.0 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 22 8.0 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 22 8.0 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 22 8.0 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 22 8.0 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 22 8.0 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 22 8.0 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 22 8.0 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 22 8.0 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 22 8.0 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 22 8.0 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 22 8.0 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 0.86 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 120 CHCRVVDGGRPRRRWCSGCGT 182 C C V + GR R+C C T Sbjct: 656 CRCTVTEDGRYTGRYCEKCPT 676 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 230 DSGLVAAAKHTPVH 271 D GLV+ A H PVH Sbjct: 808 DGGLVSNAPHIPVH 821 >AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 protein. Length = 45 Score = 23.0 bits (47), Expect = 4.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 168 SGCGTGSISATTCR 209 SGCG+G AT C+ Sbjct: 14 SGCGSGQPCATDCK 27 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 6.0 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 169 LHQRLLGRPPSTTRQWQAVRSEG 101 LH+ ++ RPP + + +EG Sbjct: 329 LHEEIINRPPQVPGERDRIANEG 351 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 6.0 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 169 LHQRLLGRPPSTTRQWQAVRSEG 101 LH+ ++ RPP + + +EG Sbjct: 329 LHEEIINRPPQVPGERDRIANEG 351 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.2 bits (45), Expect = 8.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 141 GGRPRRRWCSGC 176 GG P R+W S C Sbjct: 895 GGFPLRKWASNC 906 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 66 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 107 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 66 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 107 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 68 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 109 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 68 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 109 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 71 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 112 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 71 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 112 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 81 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 122 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 83 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 124 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 83 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 124 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 65 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 106 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 65 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 106 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 227 FDSGLVAAAKHTPVHKK*NSTFCHLCNDNKLQFRSRIFLLQP 352 +++ +V ++HTP + +C C F+ I L+P Sbjct: 80 YETNIVPKSRHTPQIIMFYADWCFACMKAANSFKKLIDTLEP 121 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 141 GGRPRRRWCSGCGTG 185 GG P RRW TG Sbjct: 111 GGEPSRRWTRSGATG 125 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 141 GGRPRRRWCSGCGTG 185 GG P RRW TG Sbjct: 111 GGEPSRRWTRSGATG 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 354,980 Number of Sequences: 2352 Number of extensions: 6045 Number of successful extensions: 71 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -