BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E17 (426 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.12 |rps602|rps6-2, rps6|40S ribosomal protein S6|Schizo... 188 4e-49 SPAC13G6.07c |rps601|rps6-1|40S ribosomal protein S6|Schizosacch... 187 5e-49 SPAC29A4.04c |||pseudouridylate synthase |Schizosaccharomyces po... 26 2.1 SPAC6B12.05c |||chromatin remodeling complex subunit |Schizosacc... 25 6.5 SPCC1259.11c |gyp2||GTPase activating protein Gyp2 |Schizosaccha... 24 8.6 >SPAPB1E7.12 |rps602|rps6-2, rps6|40S ribosomal protein S6|Schizosaccharomyces pombe|chr 1|||Manual Length = 239 Score = 188 bits (457), Expect = 4e-49 Identities = 86/126 (68%), Positives = 101/126 (80%) Frame = +3 Query: 45 MKLNVSYPATGCQKLFEVVDEHKLRIFYEKRMGAEVDADLLGDEWKGYVLRVAGGNDKQG 224 MKLN+SYPA G QKL E+ D+ +LR+F EKRMG EV D +G E+ GYV ++ GGNDKQG Sbjct: 1 MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQG 60 Query: 225 FPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKRKSVRGCIVDANLSVLALVIVRKGAQE 404 FPM QGVL RVRLL+ GH CYRPRRDGERKRKSVRGCIV +L+VLAL IV++G Q+ Sbjct: 61 FPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIVKQGEQD 120 Query: 405 IPGLTD 422 IPGLTD Sbjct: 121 IPGLTD 126 >SPAC13G6.07c |rps601|rps6-1|40S ribosomal protein S6|Schizosaccharomyces pombe|chr 1|||Manual Length = 239 Score = 187 bits (456), Expect = 5e-49 Identities = 85/126 (67%), Positives = 101/126 (80%) Frame = +3 Query: 45 MKLNVSYPATGCQKLFEVVDEHKLRIFYEKRMGAEVDADLLGDEWKGYVLRVAGGNDKQG 224 MKLN+SYPA G QKL E+ D+ +LR+F EKRMG EV D +G E+ GYV ++ GGNDKQG Sbjct: 1 MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQG 60 Query: 225 FPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKRKSVRGCIVDANLSVLALVIVRKGAQE 404 FPM QGVL RVRLL+ GH CYRPRRDGERKRKSVRGCIV +L+VLAL I+++G Q+ Sbjct: 61 FPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIIKQGEQD 120 Query: 405 IPGLTD 422 IPGLTD Sbjct: 121 IPGLTD 126 >SPAC29A4.04c |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 26.2 bits (55), Expect = 2.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 289 EWPFDIKRRTRLLVRTPCFIGKPCLSLP 206 EWP +K +LLVRT + PC + P Sbjct: 26 EWPLLLKNFDKLLVRTGHYTPIPCGNNP 53 >SPAC6B12.05c |||chromatin remodeling complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 295 Score = 24.6 bits (51), Expect = 6.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 267 LLMSKGHSCYRPRRDGERKRKSVRGCIVD 353 ++ SK +S +P+ G KRK+ R +VD Sbjct: 97 VVTSKKNSRSKPKNGGASKRKASRRTVVD 125 >SPCC1259.11c |gyp2||GTPase activating protein Gyp2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 720 Score = 24.2 bits (50), Expect = 8.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 87 LFEVVDEHKLRIFYEKRMGAEVDADLLGDEW 179 +FE V EH L Y+K + ++D L+ W Sbjct: 349 VFEYVLEHTLPHLYQKIIELDMDLKLITINW 379 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,694,109 Number of Sequences: 5004 Number of extensions: 31842 Number of successful extensions: 65 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 152416050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -