BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E14 (206 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC082767-1|AAH82767.1| 276|Homo sapiens ZNF552 protein protein. 28 6.3 BC062982-1|AAH62982.1| 276|Homo sapiens ZNF552 protein protein. 28 6.3 BC046237-1|AAH46237.1| 276|Homo sapiens ZNF552 protein protein. 28 6.3 >BC082767-1|AAH82767.1| 276|Homo sapiens ZNF552 protein protein. Length = 276 Score = 27.9 bits (59), Expect = 6.3 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -2 Query: 205 ELCFLRRVFVRL-GFSTFFSGEAFDFLLTTRSLLRRIFTFYKLNDVTNSKTERIQLFCSG 29 E F +R + + G S+ FS DFLL + LL++ T +NSKTE + LF G Sbjct: 22 EALFAKRCKLHVSGESSVFSESGKDFLLRS-GLLQQEATH---TGKSNSKTECVSLFHGG 77 Query: 28 KT 23 K+ Sbjct: 78 KS 79 >BC062982-1|AAH62982.1| 276|Homo sapiens ZNF552 protein protein. Length = 276 Score = 27.9 bits (59), Expect = 6.3 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -2 Query: 205 ELCFLRRVFVRL-GFSTFFSGEAFDFLLTTRSLLRRIFTFYKLNDVTNSKTERIQLFCSG 29 E F +R + + G S+ FS DFLL + LL++ T +NSKTE + LF G Sbjct: 22 EALFAKRCKLHVSGESSVFSESGKDFLLRS-GLLQQEATH---TGKSNSKTECVSLFHGG 77 Query: 28 KT 23 K+ Sbjct: 78 KS 79 >BC046237-1|AAH46237.1| 276|Homo sapiens ZNF552 protein protein. Length = 276 Score = 27.9 bits (59), Expect = 6.3 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -2 Query: 205 ELCFLRRVFVRL-GFSTFFSGEAFDFLLTTRSLLRRIFTFYKLNDVTNSKTERIQLFCSG 29 E F +R + + G S+ FS DFLL + LL++ T +NSKTE + LF G Sbjct: 22 EALFAKRCKLHVSGESSVFSESGKDFLLRS-GLLQQEATH---TGKSNSKTECVSLFHGG 77 Query: 28 KT 23 K+ Sbjct: 78 KS 79 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,649,014 Number of Sequences: 237096 Number of extensions: 359893 Number of successful extensions: 535 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 76,859,062 effective HSP length: 47 effective length of database: 65,715,550 effective search space used: 1380026550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -