BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E11 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.06c |rpl44|rpl28|60S ribosomal protein L28/L44|Schizosa... 82 4e-17 SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharo... 25 8.4 >SPAC1687.06c |rpl44|rpl28|60S ribosomal protein L28/L44|Schizosaccharomyces pombe|chr 1|||Manual Length = 134 Score = 82.2 bits (194), Expect = 4e-17 Identities = 51/128 (39%), Positives = 70/128 (54%), Gaps = 3/128 (2%) Frame = +1 Query: 64 MSSHLNWMIIRNNNAFLVKKANIKK-PFSKEPNNVTNLNSYRYNGLIHKKAVGVVENPDR 240 +S+ L W +IR+NN FLVK+ F++EP NV+ N+ R++GL + KAVGV N R Sbjct: 3 VSNDLIWQVIRDNNRFLVKRPEFGGIQFNREPVNVSGKNAQRFSGLCNDKAVGVQANSPR 62 Query: 241 KGFTIVYKKAKATNKPVKNIIRRPFKAGARRSLFK--AKRLLKANHYRTDLTKATLRRAS 414 I K KP K + + R +K A R+ + YR DL K ++ RAS Sbjct: 63 GVVLITKTNPKNAQKPAKLFRKDVIANASSRKTYKSIAGRIGRTG-YRDDLVKVSVARAS 121 Query: 415 AILRSQRP 438 AIL SQRP Sbjct: 122 AILSSQRP 129 >SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 840 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 79 NWMIIRNNNAFLVKKANI 132 NWM R N L++KAN+ Sbjct: 289 NWMSKRRRNESLIQKANV 306 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,800,217 Number of Sequences: 5004 Number of extensions: 33896 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -