BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E05 (451 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-18 SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) 32 0.25 SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) 30 0.77 SB_35738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_22061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 28 3.1 SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) 28 4.1 SB_817| Best HMM Match : Peptidase_S28 (HMM E-Value=0) 28 4.1 SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) 27 5.4 SB_31638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_55003| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-35) 27 9.5 SB_36890| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 87.4 bits (207), Expect = 5e-18 Identities = 40/65 (61%), Positives = 55/65 (84%) Frame = +2 Query: 194 MRYVAAYLLAVLGGKASPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEELIEAGRG 373 MRYVAAYLLA LG +P+A D++ IL SVGIE+D E+L KVISEL+GK+V+E+I+AG+ Sbjct: 650 MRYVAAYLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGKSVDEIIQAGKS 709 Query: 374 KLSSM 388 KL+++ Sbjct: 710 KLATV 714 >SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) Length = 694 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 242 SPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEEL 355 SP+ AD+E IL G E EK+K+ + L K +L Sbjct: 540 SPSKADMEAILHDYGAELSEEKMKECMKALKTKKFSKL 577 >SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 30.7 bits (66), Expect = 0.58 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 242 SPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEEL 355 +P+ AD++ IL G+E EK+K+ + L K +L Sbjct: 544 TPSKADMKAILHDYGVELSEEKMKEYMKALKTKKFSKL 581 >SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) Length = 635 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 218 LAVLGGKASPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEEL 355 +AVL +P AD++ IL G E EK+K+ + L K +L Sbjct: 375 IAVLVDFYTPRKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 420 >SB_35738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 29.9 bits (64), Expect = 1.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 242 SPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEEL 355 +P+ AD++ IL G E EK+K+ + L K +L Sbjct: 285 TPSKADIKAILHDYGAELSEEKMKEYMKALKTKKFSKL 322 >SB_22061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +2 Query: 230 GGKASPAAADVEKILSSVGIEADSEKL-KKVISELNGKNVEELIEAGRGKLS 382 GG+ A+ D+E IL S ++ DS + +VISE E+L E + KL+ Sbjct: 475 GGEGKKASEDLESILDSPHVDTDSRDVPPQVISETK----EKLEENSKSKLA 522 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 242 SPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEEL 355 +P+ AD+ IL G E EK+K+ + L K +L Sbjct: 909 TPSKADINVILHDYGAELSEEKMKENMKALKTKKFSKL 946 >SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) Length = 1117 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +2 Query: 218 LAVLGGKASPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEELIE 361 +A L +P+ AD++ IL G E K+K+ + L VEE++E Sbjct: 367 IAALVVSYTPSKADIKAILHDYGAELSEGKMKEYMKAL---QVEEVLE 411 >SB_817| Best HMM Match : Peptidase_S28 (HMM E-Value=0) Length = 826 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 197 RYVAAYLLAVLGGKASPAAADVEKILSSVGIEAD 298 R VA + V+GGKA P VE + SVG+ D Sbjct: 774 RIVADDITGVIGGKAPPCQGKVEAV-GSVGVIGD 806 >SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) Length = 1225 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 242 SPAAADVEKILSSVGIEADSEKLKKVI 322 +P+ AD++ IL G+E EK+K+ + Sbjct: 416 TPSKADMKAILHDYGVELSEEKMKEAL 442 >SB_31638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1526 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 212 YLLAVLGGKASPAAADVEKILSSVGIEADSEKLKKV 319 +LL V GKA + E +LSSV ++ SEKL+K+ Sbjct: 1345 WLLHVNRGKAFVNSQTKETLLSSVCLQTLSEKLEKL 1380 >SB_55003| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-35) Length = 303 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 136 CKTNILFSAIHVSCLSDLKNALRGR 210 C +L+ AI S +DL+N LRGR Sbjct: 243 CLNPLLYGAISKSFRTDLRNFLRGR 267 >SB_36890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1881 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 242 SPAAADVEKILSSVGIEADSEKLKKVISELNGKNVEEL 355 +P+ AD++ IL G + EK+K ++ E+ + EE+ Sbjct: 1369 TPSKADIKAILHDYGAQLSEEKMKYLV-EVKRMSAEEV 1405 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,648,157 Number of Sequences: 59808 Number of extensions: 156906 Number of successful extensions: 366 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -