BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_E01 (418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_47413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 >SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 28.7 bits (61), Expect = 2.0 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -3 Query: 257 FCINSYDLQTNEDVKIDTNLEQYPVLVHDLQFCVTLYLKIINTWPTWHQTIATKIV 90 F ++ Y L+ + D K+DT + Q L+ DL + Y+ W WH KIV Sbjct: 55 FLLSRYKLKFSPD-KVDTMIVQAISLLDDLDKELNNYVMRCREWYGWHFPELGKIV 109 >SB_47413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 126 PGVNNFQV*CNTKLKIMY 179 PG+NN V CNT K MY Sbjct: 129 PGINNPAVICNTNFKYMY 146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,337,366 Number of Sequences: 59808 Number of extensions: 203480 Number of successful extensions: 314 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -