BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D24 (435 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 29 0.054 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 28 0.13 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 28 0.17 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 27 0.29 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 27 0.29 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 27 0.29 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 26 0.67 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 26 0.67 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 26 0.67 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 26 0.67 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 0.88 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 25 1.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 2.0 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 24 2.7 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 2.7 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 3.6 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 3.6 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 3.6 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 3.6 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 3.6 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 3.6 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 3.6 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 3.6 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 3.6 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 3.6 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 23 3.6 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 23 4.7 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 23 4.7 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 4.7 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 6.2 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 6.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 22 8.2 AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 22 8.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 8.2 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 22 8.2 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 29.5 bits (63), Expect = 0.054 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 CY C +RGH ARDC Sbjct: 390 CYRCLERGHLARDC 403 Score = 25.4 bits (53), Expect = 0.88 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C CG GHYA+ C Sbjct: 413 CIRCGADGHYAKSC 426 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 28.3 bits (60), Expect = 0.13 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 CY C +RGH +RDC Sbjct: 406 CYRCLERGHVSRDC 419 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 27.9 bits (59), Expect = 0.17 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 CY C +RGH AR+C Sbjct: 364 CYRCLERGHIAREC 377 Score = 25.4 bits (53), Expect = 0.88 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C CG GH A+DC Sbjct: 387 CIRCGAEGHLAKDC 400 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 27.1 bits (57), Expect = 0.29 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 CY C + GH ARDC Sbjct: 551 CYRCLEHGHNARDC 564 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 27.1 bits (57), Expect = 0.29 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C+ C + GH++RDC Sbjct: 418 CFKCWETGHFSRDC 431 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 27.1 bits (57), Expect = 0.29 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C CG GH ARDC Sbjct: 500 CIRCGSEGHKARDC 513 Score = 24.2 bits (50), Expect = 2.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 CY C +RGH A C Sbjct: 477 CYRCLERGHLAHAC 490 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 0.67 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + HH HH + T++ HG +L HH Sbjct: 199 IAHHAAPIAHHAAPIAHSTSSIVHGPSHLSHH 230 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -2 Query: 386 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 H+ + HH + HH+ V A A H + H Sbjct: 32 HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQH 66 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.8 bits (54), Expect = 0.67 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + HH HH + T++ HG +L HH Sbjct: 201 IAHHAAPIAHHAAPIAHSTSSIVHGPSHLSHH 232 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 0.67 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + HH HH + T++ HG +L HH Sbjct: 199 IAHHAAPIAHHAAPIAHSTSSIVHGPSHLSHH 230 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -2 Query: 386 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 H+ + HH + HH+ V A A H + H Sbjct: 32 HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQH 66 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.8 bits (54), Expect = 0.67 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 CY C + GH+A DC Sbjct: 662 CYRCLELGHWAHDC 675 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 25.4 bits (53), Expect = 0.88 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C+ CG GH RDC Sbjct: 76 CFFCGQPGHKKRDC 89 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 24.6 bits (51), Expect = 1.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C+ C +RGH R+C Sbjct: 236 CFRCLERGHMVREC 249 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 2.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C++C +GH AR+C Sbjct: 377 CFNCLRKGHSAREC 390 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 23.8 bits (49), Expect = 2.7 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 374 CHHNHSSGHHMDVVVAE-TAAEDHGRHNLV 288 CH +SG MDV+ + AA D H L+ Sbjct: 55 CHAAFASGAQMDVIYTDLKAAFDRVNHRLL 84 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.8 bits (49), Expect = 2.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C CG GH R+C Sbjct: 352 CIKCGQEGHKIREC 365 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 3.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 386 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLV 288 H+ H +H HH A A H +HN++ Sbjct: 496 HSHHAHPHHHHHHHHHHPTAADLAGYHHQHNVI 528 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 Score = 22.2 bits (45), Expect = 8.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -2 Query: 386 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLV 288 H+++ HH + HH+ + A A H +V Sbjct: 32 HSSIQHHAAPAIHHVGSIHAAPAIYQHSAPTIV 64 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 206 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 237 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 206 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 237 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 386 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 H+++ HH + HH+ V A A H + H Sbjct: 32 HSSIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQH 66 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 230 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 261 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 206 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 237 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.4 bits (48), Expect = 3.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C+ C +RGH DC Sbjct: 291 CFRCLERGHTTADC 304 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 335 VVAETAAEDHGRHNLVH 285 VVA A+ GRH+LVH Sbjct: 16 VVACAQAQPSGRHHLVH 32 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 335 VVAETAAEDHGRHNLVH 285 VVA A+ GRH+LVH Sbjct: 16 VVACAQAQPSGRHHLVH 32 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 4.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 377 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 282 + H+ HH + T++ HG +L HH Sbjct: 198 ITHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 22.6 bits (46), Expect = 6.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C CG GH AR C Sbjct: 531 CIRCGLTGHKARSC 544 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 22.6 bits (46), Expect = 6.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 279 LMVDEVMAAVVLRRGLGYHHVHMMTAAMIV 368 L + +AA + + LG+HH H+ + +V Sbjct: 268 LQSEAQLAAALKLKTLGHHHHHLPPSTALV 297 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 22.2 bits (45), Expect = 8.2 Identities = 9/27 (33%), Positives = 9/27 (33%) Frame = -2 Query: 362 HSSGHHMDVVVAETAAEDHGRHNLVHH 282 H HH A T H H HH Sbjct: 707 HHLSHHHGGAAAATGHHHHQHHAAPHH 733 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 22.2 bits (45), Expect = 8.2 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +2 Query: 74 YVGDLGNNASKPELEDAFSYYGPLRNVWVARNPPGFAFV---EFED--PRDAEDAIR--G 232 +VGDLGN A+ SY + +++ AR+ G A V E +D + D+++ Sbjct: 99 HVGDLGNIAADENGIAKTSYSDTVVSLYGARSVIGRAIVIHAEVDDLGKTNHPDSLKTGN 158 Query: 233 LDGRTICG 256 GR CG Sbjct: 159 AGGRVACG 166 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 8.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 16 SHFVHLKFRHHVALWRLQNL 75 +HFVHL R W QNL Sbjct: 1123 AHFVHLCNRGQWPSWMKQNL 1142 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 22.2 bits (45), Expect = 8.2 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 356 CYDCGDRGHYARDC 397 C+ C GH RDC Sbjct: 204 CHRCRKPGHMKRDC 217 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 432,130 Number of Sequences: 2352 Number of extensions: 8033 Number of successful extensions: 65 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -