BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D22 (420 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 230 3e-61 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 48 3e-06 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 38 0.003 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) 30 0.68 SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) 30 0.68 SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) 30 0.68 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.89 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 1.2 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 29 1.2 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 29 2.1 SB_51982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 29 2.1 SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) 29 2.1 SB_13788| Best HMM Match : rve (HMM E-Value=0.00016) 29 2.1 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 28 2.7 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 28 3.6 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 28 3.6 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 28 3.6 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 3.6 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 28 3.6 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 3.6 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 28 3.6 SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 27 4.8 SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) 27 6.3 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_19250| Best HMM Match : SOCS_box (HMM E-Value=1) 27 8.3 SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) 27 8.3 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 27 8.3 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 27 8.3 SB_26806| Best HMM Match : Annexin (HMM E-Value=0) 27 8.3 SB_20319| Best HMM Match : IncA (HMM E-Value=0.2) 27 8.3 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 230 bits (563), Expect = 3e-61 Identities = 102/137 (74%), Positives = 121/137 (88%) Frame = +1 Query: 10 GDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQISNGYTPVLDCH 189 GDNVGFNVKNVSVK+++RG VAGD KNNPP+ FTAQVIV+NHPG+I GY+PVLDCH Sbjct: 164 GDNVGFNVKNVSVKDIKRGNVAGDFKNNPPKPCKSFTAQVIVMNHPGEIHAGYSPVLDCH 223 Query: 190 TAHIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRF 369 TAHIACKF ++ EK+DRR+GK EDNPK IK+GDAA+V ++PSKP+CVE+F EFPPLGRF Sbjct: 224 TAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFPPLGRF 283 Query: 370 AVRDMRQTVADGVIKAV 420 AVRDM+QTVA GVIK+V Sbjct: 284 AVRDMKQTVAVGVIKSV 300 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 48.0 bits (109), Expect = 3e-06 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +1 Query: 232 VDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRD 381 +D++TGK + P+ IK AI L +C+E F +F +GRF +RD Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +1 Query: 295 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVADGVI 411 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 31.5 bits (68), Expect = 0.29 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 4 RGGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQISNGY 168 R G + + + ELRRG V D P R F A V +L HP IS + Sbjct: 375 RAGQSASAALSGIERHELRRGMVMTDPSLEP-RACMCFWADVYLLFHPAAISKRF 428 >SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 624 Score = 31.5 bits (68), Expect = 0.29 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 169 TPVLDCHTAHIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVE 336 TPVL TAH+ K ++ + D P ++KS ++VN V S L E Sbjct: 223 TPVLRIKTAHVTDKDNRVRSVLIIDNISQAPDTPATLKSSSDSVVNSVGSVGLVAE 278 >SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 382 Score = 30.3 bits (65), Expect = 0.68 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -3 Query: 403 RRRPSASCHARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 RR P +A+ G+ + R P G WR +PG +WR Sbjct: 131 RRPPGVHRYAKAAPSGIKLVERNPRYGEWRHKKPGYEWR 169 >SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 418 Score = 30.3 bits (65), Expect = 0.68 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -3 Query: 403 RRRPSASCHARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 RR P +A+ G+ + R P G WR +PG +WR Sbjct: 167 RRPPGVHRYAKAAPSGIKLVERNPRYGEWRHKKPGYEWR 205 >SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) Length = 500 Score = 30.3 bits (65), Expect = 0.68 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -3 Query: 403 RRRPSASCHARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 RR P +A+ G+ + R P G WR +PG +WR Sbjct: 178 RRPPGVHRYAKAAPSGIKLVERNPRYGEWRHKKPGYEWR 216 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 29.9 bits (64), Expect = 0.89 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 197 T*PANLPKSKRKSTVVLVNQQRTTLNPLNLVMPP 298 T PA P + RK+T Q RTT P PP Sbjct: 1459 TVPATKPPTTRKTTTATTTQGRTTRKPTTTAEPP 1492 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 407 TPSATVCLMSRTAKRPRGGNSWKDSTHRGLEG 312 TPS VCL+SR + PR W R + G Sbjct: 282 TPSLYVCLLSRAHRDPRLSTGWSPYEKREVRG 313 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 196 HIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKP 324 HIA K E+K D ++ K+ + PK++ SGD ++VP++P Sbjct: 74 HIAKKL-EVK---DSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 28.7 bits (61), Expect = 2.1 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 242 VLVNQQRTTLNPLNLVMPPLSTWFPPSPCVWSPSRNSHP 358 + + +Q + P PP ++PP+P + P++ S+P Sbjct: 163 LFILRQHPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYP 201 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A+ GV + GR P G WR PG +WR Sbjct: 19 YAKAVPSGVKLVGRNPRYGEWRHKRPGYEWR 49 >SB_51982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 28.7 bits (61), Expect = 2.1 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 250 KSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPP--LGRFAVRDMRQTVAD 402 KST+DN S S A V SK + V S +E PP + R V ++Q D Sbjct: 57 KSTKDNGNSKGSSSRASERGVGSKQVSVSSLKEAPPRVVKRHTVSSLQQFKLD 109 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 306 VDNGGITRFNGFRVVLC*FTSTTVDFLFDFGKFAG 202 VDN G+ N F V++C T+D++FD + +G Sbjct: 1700 VDNAGMYAENAFTVLVC--DRNTIDYIFDEVQLSG 1732 >SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) Length = 925 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = -1 Query: 135 HNDLRCEVCSSPGWVVFRISC------NVTTAQFLDRYVFD 31 H ++C VC GW + R+ C + TT Q ++FD Sbjct: 172 HRRVKCSVCKKVGWSMDRLVCETCGLRSFTTVQAFSDWLFD 212 >SB_13788| Best HMM Match : rve (HMM E-Value=0.00016) Length = 508 Score = 28.7 bits (61), Expect = 2.1 Identities = 24/75 (32%), Positives = 36/75 (48%) Frame = +2 Query: 8 AVTMLVSTSKTYLSRNCAVVTLQEIRKTTHPGELQTSQRKSLC*ITQVKYQTDTHLYWIA 187 +VT+ VST T LS T++ R TH Q+S+ S C +Q + Q D L W + Sbjct: 24 SVTLEVSTL-TALSAYYEGATVERRRAHTH----QSSENLSCCRRSQEECQVDERLIWSS 78 Query: 188 TQPT*PANLPKSKRK 232 P + +K+K Sbjct: 79 RCTKKPPSKEAAKKK 93 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 141 SPRSNIKRIHTCIGLPHSPHSLQICR 218 SP+ KR T GLP S HSL CR Sbjct: 537 SPKMKKKRPKTGEGLPGSKHSLDSCR 562 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 ++++P++P CV SF EF + +RD+ Q Sbjct: 381 MSVMPAQPQCVASFPEFCAVSVSYIRDLLQ 410 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 385 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 414 >SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) Length = 549 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 389 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 418 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 1044 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1073 >SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 532 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 561 >SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) Length = 1285 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 1111 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1140 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 184 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 87 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 116 >SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 1616 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 206 QAMWAVWQSNTGVYPFDI*PG*FSTMTCAVKSA-APLGGLFFESPA 72 Q +AVW + G + + PG +ST + V+S+ A GG E+ A Sbjct: 78 QLNFAVWCATAGCFTSTLPPGGYSTSSAPVRSSIAGAGGPAMEAQA 123 >SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A++ GV + R+P G WR +PG +WR Sbjct: 657 YAKKVPSGVKLVERSPRYGEWRHKKPGYEWR 687 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A++ GV + R+P G WR +PG +WR Sbjct: 659 YAKKVPSGVKLVERSPRYGEWRHKKPGYEWR 689 >SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 27.1 bits (57), Expect = 6.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 128 TCAVKSAAPLGGLFFESPAT*PRRNSLTDTFLTLKPTLSPP 6 T V + + L G ++ T P +S +DT LT+ T+ PP Sbjct: 1081 TFRVNTPSVLLGYEYQKRTTGPGTSSRSDTLLTMFVTIEPP 1121 >SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) Length = 314 Score = 27.1 bits (57), Expect = 6.3 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -3 Query: 385 SCHARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 S +A+ GV + R P G WR +PG +WR Sbjct: 71 SIYAKAVPSGVKLVERNPRYGEWRHKKPGYEWR 103 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 27.1 bits (57), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 269 GLSSVDLPVRRSTFSL-ISANLQAMWAVWQS 180 G++++ LP ST + NLQ W +WQS Sbjct: 2463 GITTIPLPSSSSTPIIDFEVNLQGEWILWQS 2493 >SB_19250| Best HMM Match : SOCS_box (HMM E-Value=1) Length = 252 Score = 26.6 bits (56), Expect = 8.3 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 9/77 (11%) Frame = +2 Query: 44 LSRNCAVVTLQEIRKTTHPGELQTSQRKSLC*ITQVKYQTDTHLYWIATQPT-------- 199 LS +C + L HPG L +S RKS I QV L ++ + T Sbjct: 135 LSLSCKSIVLILQVYCPHPGSLLSSSRKSTVLIPQVYCPYPASLLSLSCKSTVLIPQVYC 194 Query: 200 -*PANLPKSKRKSTVVL 247 PA+L S RKS V++ Sbjct: 195 PYPASLLSSSRKSIVLI 211 >SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) Length = 748 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A+ GV + R P G WR PG +WR Sbjct: 640 YAKEISNGVKLVERNPRYGEWRHKRPGYEWR 670 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A+ GV + R P G WR PG +WR Sbjct: 640 YAKEISNGVKLVERNPRYGEWRHKRPGYEWR 670 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A+ GV + R P G WR PG +WR Sbjct: 551 YAKAEPSGVKLVERNPRYGEWRHKRPGYEWR 581 >SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) Length = 231 Score = 26.6 bits (56), Expect = 8.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 301 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 390 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFFAVSVSYIRDILQ 32 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 379 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 293 +A+ GV I R P G WR +PG +WR Sbjct: 447 YAKAVPSGVKIVERNPRYGEWRHKKPGYEWR 477 >SB_26806| Best HMM Match : Annexin (HMM E-Value=0) Length = 829 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 181 DCHTAHIACKFAE-IKEKVDRRTGKSTEDNPKSIKSGD 291 D T + A K + IKE+ ++ G S ED+ K SGD Sbjct: 77 DARTLYFAMKNIDSIKEEYQKKYGCSLEDDVKEETSGD 114 >SB_20319| Best HMM Match : IncA (HMM E-Value=0.2) Length = 566 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 108 CRLHSASHCAKSPRSNIKRIHTCIGLPHSPHSLQICRNQRE 230 C++ +A H SP + IH G H+ +I QRE Sbjct: 345 CKIRAAEHLVASPSAPDGEIHIVEGTAHTYRLQKISAIQRE 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,132,074 Number of Sequences: 59808 Number of extensions: 380466 Number of successful extensions: 1275 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 1185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1271 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -