BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D22 (420 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 28 0.12 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 28 0.12 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 24 2.0 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 23 3.4 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 3.4 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 3.4 AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 3.4 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 4.5 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 22 7.9 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 22 7.9 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 28.3 bits (60), Expect = 0.12 Identities = 15/60 (25%), Positives = 30/60 (50%) Frame = +2 Query: 191 QPT*PANLPKSKRKSTVVLVNQQRTTLNPLNLVMPPLSTWFPPSPCVWSPSRNSHPSVVS 370 +P P P+ K V+ + +R ++MP ++ W P + P+ NS+P++V+ Sbjct: 49 RPLIPDEAPQQPEKWEEVMADVER-------VIMPGVTHWHSPKFHAYFPTANSYPAIVA 101 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 28.3 bits (60), Expect = 0.12 Identities = 15/60 (25%), Positives = 30/60 (50%) Frame = +2 Query: 191 QPT*PANLPKSKRKSTVVLVNQQRTTLNPLNLVMPPLSTWFPPSPCVWSPSRNSHPSVVS 370 +P P P+ K V+ + +R ++MP ++ W P + P+ NS+P++V+ Sbjct: 80 RPLIPDEAPQQPEKWEEVMADVER-------VIMPGVTHWHSPKFHAYFPTANSYPAIVA 132 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.2 bits (50), Expect = 2.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 105 SCRLHSASHCAKSPRSNIKRIH 170 S RLH+A CA+ PR K H Sbjct: 95 SRRLHAAGFCARRPRKVRKLQH 116 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 105 SCRLHSASHCAKSPR 149 S RLH+A CA+ PR Sbjct: 23 SRRLHAAGFCARRPR 37 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 3.4 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 93 PTQGSC-RLHSASHCAKSPRSNIKRIHTCIGLPHSPHSLQICRNQ 224 P + C R H A + RS R + CI + H + C+N+ Sbjct: 503 PERQRCFRCLEMGHIASNCRSTADRQNLCIRCGLTGHKARSCQNE 547 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -3 Query: 262 PLLIYQYDGRLSL*FRQICRLCGLCGNPIQVC 167 P +YQY + Q+ C NPI C Sbjct: 493 PTFVYQYVNSSGIALVQLMAYISSCCNPITYC 524 >AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 165 IHTCIGLPHSPHSLQICR 218 I + GLPH+ + QICR Sbjct: 26 IFSAAGLPHNEIAAQICR 43 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 4.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 285 W*CRHCQPGSLQAPVCGVLPGIPTPRS 365 W RH GSL VC +L PTP S Sbjct: 12 WRRRHLLTGSLLLLVCLLLAIDPTPVS 38 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 410 ITPSATVCLMSRTA 369 I+P+ATVC MS+ A Sbjct: 616 ISPNATVCPMSKGA 629 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 22.2 bits (45), Expect = 7.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 417 SLYYTVGDRLPHVTHGETTEGWEFLEGL 334 SLY V R P V G TT+ + L Sbjct: 642 SLYLIVSYRKPDVNWGSTTQAQTYKNAL 669 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,227 Number of Sequences: 2352 Number of extensions: 12395 Number of successful extensions: 34 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -