BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D21 (182 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 1.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 1.4 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 20 3.1 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 20 3.1 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 19 4.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 19 5.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 19 7.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 19 7.2 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 1.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 38 AIVSLFIYFQQWNTFKI*MNLVFYFYLFEY 127 A+V + YF W K +V++ LF Y Sbjct: 214 AVVWIMCYFCIWKGVKWTGKVVYFTSLFPY 243 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 1.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 38 AIVSLFIYFQQWNTFKI*MNLVFYFYLFEY 127 A+V + YF W K +V++ LF Y Sbjct: 267 AVVWIMCYFCIWKGVKWTGKVVYFTSLFPY 296 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 19.8 bits (39), Expect = 3.1 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -2 Query: 40 RVSRPRWMPLTLV 2 +V P+++PLTL+ Sbjct: 21 KVRGPKYLPLTLI 33 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 19.8 bits (39), Expect = 3.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 143 TVVDYNTQTNKN 108 T VDY TQ N+N Sbjct: 308 TGVDYFTQINRN 319 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 19.4 bits (38), Expect = 4.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 35 NAIVSLFIYFQQWNTF 82 NAI+ LF+ + W F Sbjct: 223 NAIMGLFVLWWGWLAF 238 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 19.0 bits (37), Expect = 5.5 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -1 Query: 146 FTVVDYNTQTNKNK 105 FT++ Y T K K Sbjct: 209 FTIIGYETNDRKEK 222 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 18.6 bits (36), Expect = 7.2 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = +3 Query: 99 WCFIFICLSI 128 W + +CLSI Sbjct: 4 WLLLIVCLSI 13 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 18.6 bits (36), Expect = 7.2 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +3 Query: 96 TWCFIFICLSI 128 TW + +CL I Sbjct: 3 TWLLLVVCLGI 13 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,680 Number of Sequences: 438 Number of extensions: 603 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 40 effective length of database: 128,823 effective search space used: 2576460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits)
- SilkBase 1999-2023 -