BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D19 (334 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.14c |btf3|egd1, btt1, nac2|nascent polypeptide-associat... 58 4e-10 SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 28 0.33 SPAC824.05 |vps16||HOPS complex subunit Vps16 |Schizosaccharomyc... 27 0.99 SPCC18.02 |||membrane transporter|Schizosaccharomyces pombe|chr ... 24 5.3 SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 24 7.0 SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces p... 23 9.2 SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ... 23 9.2 >SPAC4F10.14c |btf3|egd1, btt1, nac2|nascent polypeptide-associated complex beta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 58.0 bits (134), Expect = 4e-10 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = +1 Query: 136 MNTEKLKKLQSQVRIGGKGTPRRKKKVVHVTA--ATDDXXXXXXXXXXXVNTIPGIEEVN 309 M+ KL KLQ+ RIGGKGTPRRK K +A A DD + + GI+EVN Sbjct: 1 MDPSKLAKLQAGARIGGKGTPRRKVKKPSKSAMSAADDKKVQGALKKLNMQNLAGIQEVN 60 Query: 310 MIKDDGTV 333 M K+DG V Sbjct: 61 MFKEDGGV 68 >SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 28.3 bits (60), Expect = 0.33 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 Query: 201 AQEEGCTRYSGNRR*EIAIVSQKIVSEHHSWH*RGQYD 314 A EE T GN + S+K S +HS H +G YD Sbjct: 391 AWEEDLTPQYGNLTTRLLFASKKYWSRNHSSHSQGNYD 428 >SPAC824.05 |vps16||HOPS complex subunit Vps16 |Schizosaccharomyces pombe|chr 1|||Manual Length = 835 Score = 26.6 bits (56), Expect = 0.99 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 Query: 56 ACVNN*IISLKSAARVCRE 112 A VN I SLKSAA+VC E Sbjct: 637 ATVNQRITSLKSAAKVCSE 655 >SPCC18.02 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 448 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 269 FLRDDCNFLSSVAAVTCTTF 210 FLRD NF++S+A ++ F Sbjct: 412 FLRDQFNFITSIACLSLLCF 431 >SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 176 RTCDCSFFSFSVFIMLF*CVKILDRHAQHFSVILF 72 R +FF S+F ++ C + L+ + FS+I F Sbjct: 62 RNISNTFFKKSIFFFVYYCKQALEFISTVFSIIKF 96 >SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 202 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 145 EKLKKLQSQVRIGGKGTPRRKKKV 216 +KLKK ++++ T +RK+KV Sbjct: 155 DKLKKKSKRLKLDDSHTQKRKRKV 178 >SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 932 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 220 VQPSSCASVYPYRRCAPATVVSLAFPYSLCYFNVL 116 V+P + V Y++ A VV F +L Y N L Sbjct: 691 VKPDTSKCVAIYKKAAEMDVVEAMFRIALIYLNGL 725 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,286,019 Number of Sequences: 5004 Number of extensions: 22709 Number of successful extensions: 47 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 93942212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -