BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D18 (274 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 25 0.67 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 24 0.89 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.6 bits (51), Expect = 0.67 Identities = 13/54 (24%), Positives = 25/54 (46%) Frame = +3 Query: 12 GLIVFYLDAIDNVWRL*VYNNRKADWKMAIGGGMSCVKYLLFCFNLLFAITGLI 173 GLI+F L +W + N++ W++ GG +Y++ + TG + Sbjct: 408 GLILFLLGMWMVLWEKTLDKNKEEIWQLFFGG-----RYIILLMGIFSMYTGFV 456 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 24.2 bits (50), Expect = 0.89 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 156 AITGLIILIVGIKAEINSSPYIDLTDENFYTSG 254 AI L++++ + INS PY+ L+ E T G Sbjct: 94 AIADLLVMLDYMPYAINSIPYLRLSREERLTYG 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,840 Number of Sequences: 2352 Number of extensions: 4743 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 15730956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -