BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D17 (416 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011448-1|AAR99106.1| 167|Drosophila melanogaster RE46349p pro... 29 3.3 AE013599-3991|AAF47298.1| 167|Drosophila melanogaster CG2803-PA... 29 3.3 >BT011448-1|AAR99106.1| 167|Drosophila melanogaster RE46349p protein. Length = 167 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 387 FYG*STY*ERVPVNVLTRFNLCILINKIGVSVY 289 F+ +T +++P+ + TR+N+ L+NK GV Y Sbjct: 40 FWCKATTTQKLPLVIATRYNIPFLLNKPGVGYY 72 >AE013599-3991|AAF47298.1| 167|Drosophila melanogaster CG2803-PA, isoform A protein. Length = 167 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 387 FYG*STY*ERVPVNVLTRFNLCILINKIGVSVY 289 F+ +T +++P+ + TR+N+ L+NK GV Y Sbjct: 40 FWCKATTTQKLPLVIATRYNIPFLLNKPGVGYY 72 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,521,544 Number of Sequences: 53049 Number of extensions: 220888 Number of successful extensions: 250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1251032760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -