BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D17 (416 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83216-3|CAB05674.2| 232|Caenorhabditis elegans Hypothetical pr... 26 9.5 CU457741-16|CAM36358.1| 312|Caenorhabditis elegans Hypothetical... 26 9.5 >Z83216-3|CAB05674.2| 232|Caenorhabditis elegans Hypothetical protein C08F11.3 protein. Length = 232 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 228 VFVLGIVYIFVSTQ*KKIGHYKQTLQFYLLVY 323 VF+L YI V T+ G +K+T LL+Y Sbjct: 179 VFILRFTYIHVITKRDVFGTFKKTKNVNLLMY 210 >CU457741-16|CAM36358.1| 312|Caenorhabditis elegans Hypothetical protein C42C1.15 protein. Length = 312 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/40 (25%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +2 Query: 260 IYSVKKNWSL*TDTPILFISI-HKLNRVKTLTGTRS*YVD 376 +Y++ KN+++ D P++F + H++N+ ++ + Y+D Sbjct: 98 VYAIVKNYTVDYDRPLIFNKVHHEVNQFCSVHTLQEVYID 137 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,737,628 Number of Sequences: 27780 Number of extensions: 140039 Number of successful extensions: 246 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 246 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 683806592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -