BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D16 (489 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF465821-1|AAL77003.1| 247|Homo sapiens unknown protein protein. 30 4.9 BC034571-1|AAH34571.1| 216|Homo sapiens PLA2G4D protein protein. 29 6.5 >AF465821-1|AAL77003.1| 247|Homo sapiens unknown protein protein. Length = 247 Score = 29.9 bits (64), Expect = 4.9 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 286 LSGNGQPEVRATLVTLVPYVAEHSPPKYGEAVKALPVNSCS*V*KKLQKIIYV 444 LSG+ PE +LV + EH GE KA P L+K+++V Sbjct: 189 LSGDAPPEDNKSLVVSLSKAREHGAGSLGEQFKASPTKPLVPSEAHLEKVLHV 241 >BC034571-1|AAH34571.1| 216|Homo sapiens PLA2G4D protein protein. Length = 216 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 39 HPSAAETAFPAAGDRRLTLLPHTLRIPLRRRPI 137 +PSA P A R LPHT R+P RR + Sbjct: 182 NPSAQPGQAPEASSRATEPLPHTARVPKGRRGV 214 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,510,939 Number of Sequences: 237096 Number of extensions: 1741173 Number of successful extensions: 3501 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3501 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4366354454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -