BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D14 (421 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 124 2e-29 SB_42875| Best HMM Match : RGM_C (HMM E-Value=2.6e-27) 28 2.7 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 124 bits (300), Expect = 2e-29 Identities = 58/78 (74%), Positives = 67/78 (85%), Gaps = 2/78 (2%) Frame = -3 Query: 419 RFNGGVGRCAQAKQFGT--TQGRWPKKSAEFLLQLLRNAESNADYKGLDVDRLVIDHIQV 246 ++NGGVGR AQAK +QGRWPKKSAE LLQLL+NAESNA++KGLDVD LV++HIQV Sbjct: 62 KYNGGVGRKAQAKNLKVPGSQGRWPKKSAEILLQLLKNAESNAEFKGLDVDSLVVEHIQV 121 Query: 245 NRAPCLRRRTYRAHGRIN 192 N AP +RRRTYRAHGRIN Sbjct: 122 NEAPSMRRRTYRAHGRIN 139 >SB_42875| Best HMM Match : RGM_C (HMM E-Value=2.6e-27) Length = 471 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -3 Query: 386 AKQFGTTQGRWPKKSAEFLLQLLRNAESNADYKGLDVDRLVIDHIQVNRAPCLRRRTYRA 207 AKQ +G WP FL+ + N D + IQ N+ C++++ Y+A Sbjct: 202 AKQTCVVEGAWPLVENHFLIVQVTNVPL-VDGSSATATNKITVIIQENKDSCVQQKIYKA 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,298,611 Number of Sequences: 59808 Number of extensions: 172141 Number of successful extensions: 370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -