BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D14 (421 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.5 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 7.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 9.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 3.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 269 ACQRLNLCSQHLIQHSSKVGAGILQISWANDPVWYQ 376 A + +N+ QH Q +++V ILQ + +W Q Sbjct: 920 ASRSINVKWQHKSQDTTEVTKYILQYKEGDAGIWQQ 955 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 3.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 269 ACQRLNLCSQHLIQHSSKVGAGILQISWANDPVWYQ 376 A + +N+ QH Q +++V ILQ + +W Q Sbjct: 916 ASRSINVKWQHKSQDTTEVTKYILQYKEGDAGIWQQ 951 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 20.6 bits (41), Expect = 7.5 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 131 RQHPHVHLGTPLCDRGM 181 R HPH +G C +G+ Sbjct: 110 RPHPHNLVGKEACKQGV 126 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 20.6 bits (41), Expect = 7.5 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 131 RQHPHVHLGTPLCDRGM 181 R HPH +G C +G+ Sbjct: 110 RPHPHNLVGKEACKQGV 126 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.2 bits (40), Expect = 9.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 218 TYRAHGRINPYMSSPC 171 T +AH R+ P SS C Sbjct: 64 TAQAHHRLYPAFSSSC 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,221 Number of Sequences: 438 Number of extensions: 1612 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -