BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D13 (485 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29614-6|AAA68809.2| 378|Caenorhabditis elegans Hypothetical pr... 27 9.5 AF016681-6|AAB66175.2| 317|Caenorhabditis elegans Hypothetical ... 27 9.5 >U29614-6|AAA68809.2| 378|Caenorhabditis elegans Hypothetical protein F18E9.3 protein. Length = 378 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 118 SYSDTMTMSLATALPANKLRWYKDMVSSSSATCGPR 11 S + T T + T P + +W+K S+S GPR Sbjct: 223 STTTTPTPTTTTQSPNTRAQWWKTTTSASRWVAGPR 258 >AF016681-6|AAB66175.2| 317|Caenorhabditis elegans Hypothetical protein F22E5.11 protein. Length = 317 Score = 26.6 bits (56), Expect = 9.5 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 6/63 (9%) Frame = -3 Query: 417 SREARNGLYSELITGIYL*DSAFTPKFYPHNKVIN------LYLKIIFCIFYVTLYLKKI 256 +++ ++ + S L+ L DS P+F H K I L LK+IF I ++ L + + Sbjct: 16 AQKIKDNIRSSLVNLKLLFDSQEPPEF-DHQKFIMSIVIMILLLKLIFLILFIVLVVFTL 74 Query: 255 HVI 247 H++ Sbjct: 75 HIL 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,819,443 Number of Sequences: 27780 Number of extensions: 186126 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -