BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D09 (512 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 30 0.97 SB_76| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 >SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 407 Score = 30.3 bits (65), Expect = 0.97 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -1 Query: 509 NASQLKMKRRSK*SRMVTESPQ*KDIRARHSSACSVSRNVTRW 381 N +L K R + V E P K+I A+H+ CSV+R + RW Sbjct: 300 NPGRLVPKERLEREPKVMEEPVIKEIAAKHN--CSVARVLLRW 340 >SB_76| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 174 NHRAIDGPNTIR*RSSLIREVKILSIMMMLAKKPKK-KSLY 55 N+ ++ GP+ + R+ +I E+ L ++ + KPKK SLY Sbjct: 303 NNESVPGPSGLNNRNGVILELTSLKVIELKVDKPKKCPSLY 343 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,247,630 Number of Sequences: 59808 Number of extensions: 214317 Number of successful extensions: 437 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -