BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D07 (498 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 27 0.12 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 4.7 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 4.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 6.2 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 6.2 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 26.6 bits (56), Expect = 0.12 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = -1 Query: 189 YSCDPTIRR-FHSVLPVQRVYQACHNNGLDHTARGQQGCILSGNHRKPFFLTNL--SNTI 19 Y C+ TI FHSVLP++R + + D+ + C + G H FFL + T Sbjct: 155 YVCNTTIFLIFHSVLPIKRFFTSL-GIAFDNIMKNLI-CEIDGRHE--FFLAEFKSAKTP 210 Query: 18 ENRPSC 1 N+ +C Sbjct: 211 PNKLNC 216 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.4 bits (43), Expect = 4.7 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 373 GVIQQSIY-LYMRILLYKILLVCLMYTSVTAIKL 471 GV+ Y L++ +LY +LL L Y IKL Sbjct: 162 GVVTLQAYTLHLFCVLYVVLLHFLTYNLSLGIKL 195 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.4 bits (43), Expect = 4.7 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 373 GVIQQSIY-LYMRILLYKILLVCLMYTSVTAIKL 471 GV+ Y L++ +LY +LL L Y IKL Sbjct: 162 GVVTLQAYTLHLFCVLYVVLLHFLTYNLSLGIKL 195 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 160 SFSFTCPKGVSGL 122 S++ TCP G SG+ Sbjct: 6 SYTCTCPLGFSGI 18 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 239 PPPPGSAASAHNS*RSLTPATQP 171 PP P SAA+ +S +PA P Sbjct: 12 PPAPQSAATPISSSGMTSPAAAP 34 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,675 Number of Sequences: 336 Number of extensions: 2813 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -