Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_D07
         (498 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |S...    31   0.073

>SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 891

 Score = 31.5 bits (68), Expect = 0.073
 Identities = 14/64 (21%), Positives = 34/64 (53%)
 Frame = +3

Query: 285 FQLLVGSMTFFYMINYGKMKHHRNYKYH*RSNSTINLFVHENIIIQDSTGLSHVYISYCN 464
           F+ + G     Y+I++GK+K  +  K+  +  S ++ ++H+N ++     + ++ IS   
Sbjct: 220 FEFVDGGQMLDYIISHGKLKEKQARKFVRQIGSALS-YLHQNSVVHRDLKIENILISKTG 278

Query: 465 KISV 476
            I +
Sbjct: 279 DIKI 282


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,107,974
Number of Sequences: 5004
Number of extensions: 44758
Number of successful extensions: 101
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 98
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 196153982
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)