BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D07 (498 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 27 0.27 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 24 2.5 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 24 2.5 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 2.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 2.5 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 5.8 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 7.6 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 27.5 bits (58), Expect = 0.27 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +3 Query: 126 PDTPFGQVKLNEIGGWLGRRSKTPSAV---MGACS 221 P P G L +IG + GR SKTP + +G CS Sbjct: 8 PPRPLGSA-LKDIGAFFGRSSKTPRSPPSDLGECS 41 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.2 bits (50), Expect = 2.5 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = +1 Query: 412 LLYKILLVCLMYT 450 ++Y +L++CLMYT Sbjct: 210 IIYNVLVMCLMYT 222 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.2 bits (50), Expect = 2.5 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = +1 Query: 412 LLYKILLVCLMYT 450 ++Y +L++CLMYT Sbjct: 210 IIYNVLVMCLMYT 222 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 2.5 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 248 FVLPPPPGSAASAHNS*RSLTP-ATQPSADFIQFYLSKG 135 + L PPPG +A N ++TP + D + F + G Sbjct: 491 YKLQPPPGGRPNAPNPSSAVTPGGGRAEGDKVTFQIPNG 529 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 24.2 bits (50), Expect = 2.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 135 PFGQVKLNEIGGWLGRRSKTP 197 P G L +IG + GR SKTP Sbjct: 42 PLGSA-LKDIGAFFGRSSKTP 61 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 5.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 193 VLLLRPNHPPISFSFTCPKGVS 128 V LLR PP+ F CP V+ Sbjct: 1467 VTLLRKISPPLGFGKLCPHRVA 1488 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.6 bits (46), Expect = 7.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 251 IFVLPPPPGSAASAHNS*RSL 189 IF+L PPGS S H R++ Sbjct: 385 IFILLGPPGSHGSFHEIGRAM 405 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,314 Number of Sequences: 2352 Number of extensions: 12114 Number of successful extensions: 25 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -