BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D06 (456 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_7922| Best HMM Match : SMC_C (HMM E-Value=1.5e-08) 27 9.7 >SB_42414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 28.7 bits (61), Expect = 2.4 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = -3 Query: 355 TCVRPLRKGCARQASMRFRPIVIINYA---DCNRFLTRKFTV*NRTSNLTELCYLITFLV 185 T ++P CAR + P +++ Y DC + RKF + T + + L FLV Sbjct: 157 TRLKPPEGACARALWVFTLPSILVFYVTIPDCRKKTWRKFYLVTFTVAVIWMAVLSYFLV 216 Query: 184 WL 179 W+ Sbjct: 217 WM 218 >SB_7922| Best HMM Match : SMC_C (HMM E-Value=1.5e-08) Length = 493 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 242 CKLSC*KSITVCVIDNYYRTKTH*CLSCAALPQ 340 C L C ++T CVI R T CL C A+ Q Sbjct: 199 CGLQC-VAVTQCVISVSPRQDTTCCLECVAVTQ 230 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,576,253 Number of Sequences: 59808 Number of extensions: 227663 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 920703675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -