BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_D04 (445 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 24 0.65 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 24 0.65 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 2.6 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 3.5 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 3.5 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 4.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 6.1 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 6.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 6.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 6.1 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 6.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.0 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 24.2 bits (50), Expect = 0.65 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 144 RCRQECKKSCPVVRMGKLCIEV 209 RC C++ CP V LCI++ Sbjct: 45 RCDGRCQRFCPNVVPKPLCIKI 66 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 24.2 bits (50), Expect = 0.65 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 144 RCRQECKKSCPVVRMGKLCIEV 209 RC C++ CP V LCI++ Sbjct: 45 RCDGRCQRFCPNVVPKPLCIKI 66 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.2 bits (45), Expect = 2.6 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 222 KIATISEELCIGCGI 266 K+ TI + C+ CG+ Sbjct: 534 KVETIGDAYCVACGL 548 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 3.5 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +3 Query: 285 FDAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTA 443 F+A + NI + K + ++ + H LPI G L Q G GK+ A Sbjct: 198 FEAAGLRNIVLDNIKKSGYK-KPTPVQKHALPIIMNGRDLMACAQTGSGKTAA 249 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.8 bits (44), Expect = 3.5 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -2 Query: 252 YTVLQRWSLFYHWVLLRCTVCPYAQLGN 169 Y V+ W++FY ++ +R + P+ N Sbjct: 77 YIVILAWAIFYFFMSMRSEL-PWGSCNN 103 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 4.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 305 DDGDRVKGAFLYTNTAPNTQFFRDGRYF 222 D+GDR+ + N N GRYF Sbjct: 351 DNGDRIFAEYDIINIQENGDQVSVGRYF 378 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 124 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +1 Query: 316 QIWRNTPLIVIPR 354 +IWRN + +PR Sbjct: 73 EIWRNKLFVTVPR 85 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 326 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 357 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 306 NIPSNLEKHTTHRYSKNSFKLH---RLPIPRP 392 N +N + H Y+K + ++ ++PIP P Sbjct: 326 NYNNNYNNYNKHNYNKLYYNINYIEQIPIPVP 357 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 249 CIGCGICVKKCPF 287 C+GCG KC + Sbjct: 36 CLGCGDSCHKCKY 48 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 8.0 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -1 Query: 241 SEMVAILSLGVTSMHSLPIRTTG 173 S + A +SLGVT++ ++ +T+G Sbjct: 268 SAVPARVSLGVTTLLTMATQTSG 290 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 8.0 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -1 Query: 241 SEMVAILSLGVTSMHSLPIRTTG 173 S + A +SLGVT++ ++ +T+G Sbjct: 268 SAVPARVSLGVTTLLTMATQTSG 290 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,376 Number of Sequences: 438 Number of extensions: 3288 Number of successful extensions: 32 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -