BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C22 (373 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 26 0.11 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 26 0.11 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 26 0.11 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 26 0.11 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 26 0.11 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 26 0.11 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 26 0.11 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.33 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 0.76 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 0.76 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 0.76 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.0 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 1.8 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 4.1 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 4.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 4.1 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 5.4 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 20 7.1 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 86 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 127 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 26.2 bits (55), Expect = 0.11 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTP---PVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++P P +TA+Q S AS Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.33 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTPPVLTTATQTCSWSAS 221 S P N+ SSG +SP+S +++PP AT T S + S Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPPG-KPATSTTSQNLS 167 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.4 bits (48), Expect = 0.76 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 68 RYIKMREIVHIQAGQCGNQIGAKFWEIISD 157 RY + +I ++Q G +GA+ ++I D Sbjct: 593 RYPDLNKIFYVQTDSSGYGLGAELYQIQED 622 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 0.76 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 119 NQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEA 241 N+I + W + D G AYHGD + E I ++A Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.4 bits (48), Expect = 0.76 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 99 SRPDNAETRLELSSGRSSPMSTASTPP 179 S P N+ SSG +SP+S +++PP Sbjct: 130 STPSNSNATK--SSGLTSPLSVSTSPP 154 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 1.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 69 DISK*GKSCTSRPDNAETRLELSSGRSSPMSTASTPP 179 ++SK G + P N L +SS + S + S PP Sbjct: 225 NLSKPGTPPSGEPGNGPLDLSVSSRKRSNDDSVSQPP 261 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 1.8 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 90 SCTSRPDNAETRLELSSGRSSPMSTASTPP 179 SC+ +N+++ ++++ +SP S TPP Sbjct: 408 SCSDSEENSQS--DITNNVNSPASMNQTPP 435 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 4.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 367 AGLSENEVVGPEDLSEGSRADR 302 +GL+E EVV ++EG A++ Sbjct: 84 SGLTEEEVVLSNAIAEGPDAEK 105 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 4.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 154 GDDLPELSSNLVSALSGLDVHDFPHFDISELNKLLNT 44 G+D + NL S S D H P D LN+ +++ Sbjct: 647 GNDGNQSDDNLGSCGSMGDAHTPPEDDAESLNQSISS 683 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 4.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 154 GDDLPELSSNLVSALSGLDVHDFPHFDISELNKLLNT 44 G+D + NL S S D H P D LN+ +++ Sbjct: 539 GNDGNQSDDNLGSCGSMGDAHTPPEDDAESLNQSISS 575 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 5.4 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 Query: 207 CKSESPW*APVGSMPC 160 C +E PW G PC Sbjct: 351 CVNERPWSLYCGEPPC 366 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 20.2 bits (40), Expect = 7.1 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -1 Query: 103 LDVHDFPHFDISELNKLLN 47 + + P +DI E+NK+++ Sbjct: 177 VSANPLPSYDIPEINKVVD 195 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,110 Number of Sequences: 336 Number of extensions: 1513 Number of successful extensions: 18 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7722305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -