BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C21 (203 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0767 + 21004373-21004545,21004656-21004711,21004800-210048... 28 1.2 03_02_0222 + 6540095-6540099,6541215-6541339,6541440-6541766,654... 26 3.6 >08_02_0767 + 21004373-21004545,21004656-21004711,21004800-21004882, 21004942-21005112,21005806-21005997 Length = 224 Score = 27.9 bits (59), Expect = 1.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 136 RHLCSHR*PCLRPLHC 89 R L R PCLRP+HC Sbjct: 58 RRLWQQRPPCLRPIHC 73 >03_02_0222 + 6540095-6540099,6541215-6541339,6541440-6541766, 6541815-6543215,6543268-6543357,6543800-6544515, 6545549-6545707,6545877-6546186,6546794-6546861, 6547354-6547896 Length = 1247 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 10 SGQPWKLLILVVKNIKIRTIMSTNENNSEVAVDKVND 120 +G W L+ LV + + T++ + +N+EV +V+D Sbjct: 694 TGALWNLIQLVGEQSRRNTVLLMDRDNAEVFYSRVSD 730 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.307 0.126 0.340 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,168,488 Number of Sequences: 37544 Number of extensions: 31688 Number of successful extensions: 48 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 14,793,348 effective HSP length: 47 effective length of database: 13,028,780 effective search space used: 260575600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -