Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_C21
         (203 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705395-1|AAU12504.1|  569|Anopheles gambiae nicotinic acetylch...    20   9.2  

>AY705395-1|AAU12504.1|  569|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 2 protein.
          Length = 569

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 8/33 (24%), Positives = 17/33 (51%)
 Frame = +1

Query: 19  PWKLLILVVKNIKIRTIMSTNENNSEVAVDKVN 117
           PW     +++  K+  +   N+   E+A +K+N
Sbjct: 351 PWVRKFFILRLPKLLLMRVPNDLLKELAANKIN 383


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.307    0.126    0.340 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,720
Number of Sequences: 2352
Number of extensions: 1458
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 563,979
effective HSP length: 45
effective length of database: 458,139
effective search space used: 10079058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (20.7 bits)