BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0002_C21
(203 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 20 9.2
>AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic
acetylcholine receptor subunitalpha 2 protein.
Length = 569
Score = 20.2 bits (40), Expect = 9.2
Identities = 8/33 (24%), Positives = 17/33 (51%)
Frame = +1
Query: 19 PWKLLILVVKNIKIRTIMSTNENNSEVAVDKVN 117
PW +++ K+ + N+ E+A +K+N
Sbjct: 351 PWVRKFFILRLPKLLLMRVPNDLLKELAANKIN 383
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.307 0.126 0.340
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,720
Number of Sequences: 2352
Number of extensions: 1458
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 563,979
effective HSP length: 45
effective length of database: 458,139
effective search space used: 10079058
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (20.7 bits)
- SilkBase 1999-2023 -