BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C18 (348 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 4.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 5.5 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 5.5 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 5.5 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 20 7.3 S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 20 9.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 9.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 20 9.6 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 9.6 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 20 9.6 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 9.6 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 20 9.6 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 20 9.6 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 20 9.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 20 9.6 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 9.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 9.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 9.6 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 20 9.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 20 9.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 20 9.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 20 9.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 20 9.6 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 20 9.6 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 20 9.6 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.0 bits (42), Expect = 4.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 183 KSGITSPGLLSEAMEGLTIKNQPVDKEADRRRDAWIPNDET 305 K+G+ GL++ + G ++QP+ +E D N+ET Sbjct: 314 KNGVLFFGLMNNSAIGCWNEHQPLQRE---NMDMVAQNEET 351 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 20.6 bits (41), Expect = 5.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 211 NNPGLVIPLLMGPK 170 N PG V+ + +GPK Sbjct: 529 NVPGAVVRVFLGPK 542 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 20.6 bits (41), Expect = 5.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 107 RCRPTNGWDNT*KI 66 +C PT+G DN KI Sbjct: 113 KCLPTSGSDNCNKI 126 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 20.6 bits (41), Expect = 5.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 107 RCRPTNGWDNT*KI 66 +C PT+G DN KI Sbjct: 113 KCLPTSGSDNCNKI 126 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 20.2 bits (40), Expect = 7.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 290 YPSISSSVCFFINWLVLNG 234 Y +SSS+ F++ +V+ G Sbjct: 192 YAVVSSSISFYVPCIVMLG 210 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 19.8 bits (39), Expect = 9.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 216 HLIIQGLLYHF 184 H+II GL Y F Sbjct: 56 HIIIVGLFYEF 66 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 19.8 bits (39), Expect = 9.6 Identities = 5/27 (18%), Positives = 16/27 (59%) Frame = +3 Query: 231 LTIKNQPVDKEADRRRDAWIPNDETKK 311 + ++++ ++ RR+AW+ E ++ Sbjct: 25 IDLRSRTKEERLQHRREAWLIQQERER 51 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 19.8 bits (39), Expect = 9.6 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 306 LFHHLVSKHLFVCLL 262 L +H+V + +CLL Sbjct: 2 LLYHIVGASVLICLL 16 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 19.8 bits (39), Expect = 9.6 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 217 KLWKDSPLRTNQLIKKQTD 273 ++W+D L L+KK+ + Sbjct: 112 RIWRDDALTKLSLLKKRIE 130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,412 Number of Sequences: 438 Number of extensions: 2178 Number of successful extensions: 25 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7936320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -