BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C18 (348 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12740.1 68414.m01479 cytochrome P450 family protein similar ... 29 0.64 At1g30810.1 68414.m03767 transcription factor jumonji (jmj) fami... 28 2.0 At1g24706.1 68414.m03104 expressed protein 27 2.6 At5g26360.1 68418.m03151 chaperonin, putative similar to SWISS-P... 27 4.5 At5g05170.1 68418.m00550 cellulose synthase, catalytic subunit (... 27 4.5 At2g45380.1 68415.m05645 expressed protein similar to gi2344899|... 27 4.5 At1g03687.1 68414.m00349 DTW domain-containing protein contains ... 27 4.5 At2g46550.1 68415.m05807 expressed protein 26 6.0 At1g69350.1 68414.m07958 pentatricopeptide (PPR) repeat-containi... 26 6.0 At5g45960.1 68418.m05651 GDSL-motif lipase/hydrolase family prot... 26 7.9 At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 pro... 26 7.9 At5g13370.1 68418.m01540 auxin-responsive GH3 family protein sim... 26 7.9 At5g09930.1 68418.m01148 ABC transporter family protein 26 7.9 >At1g12740.1 68414.m01479 cytochrome P450 family protein similar to Cytochrome P450 90A1 (SP:Q42569) [Arabidopsis thaliana] Length = 472 Score = 29.5 bits (63), Expect = 0.64 Identities = 21/66 (31%), Positives = 27/66 (40%) Frame = -3 Query: 262 SLSTGWFLMVSPSIASLNNPGLVIPLLMGPKLGSGPIVSKNVDGSGKLVAGSGVDPLTVG 83 ++ GW +MV P LN PL+ P G SK + S +A G VG Sbjct: 366 TIPAGWAVMVCPPAVHLNPEMYKDPLVFNPSRWEG---SKVTNASKHFMAFGGGMRFCVG 422 Query: 82 TTLEKL 65 T KL Sbjct: 423 TDFTKL 428 >At1g30810.1 68414.m03767 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains similarity to Swiss-Prot:P29375 retinoblastoma-binding protein 2 (RBBP-2) [Homo sapiens]; contains Pfam domains PF02375: jmjN domain and PF02373: jmjC domain; intron between exons 6 and 7 was required to circumvent a frameshift. There could be an underlying sequence error. Length = 787 Score = 27.9 bits (59), Expect = 2.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 198 SPGLLSEAMEGLTIKNQPVDKEADR 272 +P L SE E +++KN P DK+ D+ Sbjct: 3 NPPLESEIKEDMSLKNHPPDKDKDK 27 >At1g24706.1 68414.m03104 expressed protein Length = 1781 Score = 27.5 bits (58), Expect = 2.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 228 GLTIKNQPVDKEADRRRDAWIPNDETK 308 G+ N+ + K ++R RD+ +PNDE K Sbjct: 737 GMMRNNKALIKSSNRLRDSLLPNDEPK 763 >At5g26360.1 68418.m03151 chaperonin, putative similar to SWISS-PROT:P50143- T-complex protein 1, gamma subunit (TCP-1-gamma) [Xenopus laevis]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 555 Score = 26.6 bits (56), Expect = 4.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 151 VSKNVDGSGKLVAGSGVDPLTVGTTLEK 68 V++N+ + KLV G G LTV TL++ Sbjct: 397 VARNIIKNPKLVPGGGATELTVSATLKQ 424 >At5g05170.1 68418.m00550 cellulose synthase, catalytic subunit (Ath-B) nearly identical to gi:2827143, cellulose synthase, catalytic subunit (Ath-B) Length = 1065 Score = 26.6 bits (56), Expect = 4.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 177 PIKSGITSPGLLSEAMEGLTIKNQPVDKEADRRR 278 PIK P LLS+ G KN KE+D+++ Sbjct: 631 PIKVKHKKPSLLSKLCGGSRKKNSKAKKESDKKK 664 >At2g45380.1 68415.m05645 expressed protein similar to gi2344899|AC002388 Length = 491 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 228 GLTIKNQPVDKEADRRRDAWIPNDE 302 GLTI+ P D+E + R+D I + E Sbjct: 275 GLTIEELPSDEEVEERKDIGIDDQE 299 >At1g03687.1 68414.m00349 DTW domain-containing protein contains Pfam PF03942: DTW domain Length = 350 Score = 26.6 bits (56), Expect = 4.5 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +3 Query: 108 LPATSLPDPSTFFDTIGPEPNLGPIKSGITSPGLLSEAMEGLTIKNQPVDKEADRRRDAW 287 LP SL ++ + P+P+ + + GLLSE + + +DK+AD +A Sbjct: 262 LPCISLATGASAMHKLRPQPSWDRTCTAAAAIGLLSELSLLPQLSSYELDKQADAVEEAL 321 Query: 288 I 290 + Sbjct: 322 V 322 >At2g46550.1 68415.m05807 expressed protein Length = 397 Score = 26.2 bits (55), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 189 GITSPGLLSEAMEGLTIKNQPVDKEADRRRDAWIPNDETKKILLEA 326 G S GL ++ G TIK R +A +D +K LLEA Sbjct: 224 GFDSDGLRDYSVSGQTIKGTSKGSSCKNRPEASSESDLSKSELLEA 269 >At1g69350.1 68414.m07958 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535: PPR repeat Length = 787 Score = 26.2 bits (55), Expect = 6.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 156 GPEPNLGPIKSGITSPGLLSEAMEGLTIKNQPVDKEAD 269 G EPNL + S ++S GL+ EG ++ V +E D Sbjct: 298 GIEPNLVTLYSVLSSCGLIGLIREGKSVHGFAVRRELD 335 >At5g45960.1 68418.m05651 GDSL-motif lipase/hydrolase family protein Length = 375 Score = 25.8 bits (54), Expect = 7.9 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -3 Query: 238 MVSPSIASLNNPGLVIPLLMGPKLGSGPIVSKNVDGSGKLVAGSGVDPLT 89 +V+ IAS +P + P LG ++S G AGSG DPLT Sbjct: 93 LVTDFIASYIGVKENVPPYLDPNLGINELIS----GVSFASAGSGYDPLT 138 >At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 protein (ZFWD3) contains 5 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd3 protein (GP:12057168) {Arabidopsis thaliana} Length = 472 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = -3 Query: 154 IVSKNVDGSGKLVAGSGVDPLTVGTTLEKLISSETCC*LNEA 29 ++S ++DG+ KL A S + L V T ++ +S T C +++A Sbjct: 365 LISSSLDGTIKLWACSENESLKVVQTRKQELSVHTLCGMHDA 406 >At5g13370.1 68418.m01540 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 595 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +3 Query: 162 EPNLGPIKSGITSPGLLSEAMEGLTIKNQPVDKEADRRRDAWIPNDETKKIL 317 + N+GP++ + PG E M + V + R + N+E KIL Sbjct: 522 DKNIGPLEIKVVKPGAFDELMNFFLSRGSSVSQYKTPRS---VTNEEALKIL 570 >At5g09930.1 68418.m01148 ABC transporter family protein Length = 678 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 274 RLSASLSTGWFLMVSPSIASLNNPGLVI 191 RL AS S+GW + +S L NP L++ Sbjct: 241 RLVASFSSGWQMRMSLGKILLQNPDLLL 268 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,567,858 Number of Sequences: 28952 Number of extensions: 155060 Number of successful extensions: 371 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -