BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C16 (391 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 2.9 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 3.8 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 3.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 3.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 6.6 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.6 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 20 8.7 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 20 8.7 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 20 8.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 20 8.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 8.7 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.8 bits (44), Expect = 2.9 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -3 Query: 347 MTGASGNSKSKRACLVSPAFNTATG--IFTDSCNDIV 243 +TG GN + + +PA TAT +F+ + +D++ Sbjct: 52 VTGIFGNITTCTVIIKNPAMQTATNYYLFSLAISDLI 88 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 84 RILLRCHPVRVTSVRNM 134 R L CHP+RV ++ + Sbjct: 139 RYLAICHPLRVYTISGL 155 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 3.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 208 RPDQVVLDG*PAYYCVDILL*PLGPMFLTDVT 113 RPD G PA VDI++ +GP+ D+T Sbjct: 22 RPD---FGGPPATVEVDIMVRSMGPISEVDMT 50 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.4 bits (43), Expect = 3.8 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 358 IQGSGPVHLIG 390 I GSG VHL+G Sbjct: 181 IAGSGAVHLVG 191 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 3.8 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = +2 Query: 38 NVSQNLNKLVKSP 76 N++Q L+KL++SP Sbjct: 887 NLTQTLDKLIRSP 899 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.6 bits (41), Expect = 6.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 234 SGGDNVITGVGKNTSRSI 287 +G +ITGVGK TS ++ Sbjct: 822 TGKVEMITGVGKATSPNL 839 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -2 Query: 318 QACMSCLSCFQY 283 Q C C +C QY Sbjct: 604 QCCWHCFNCTQY 615 Score = 20.2 bits (40), Expect = 8.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -3 Query: 140 GSHVSD*CDSD 108 G+H+ D CD+D Sbjct: 168 GAHILDDCDND 178 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = -3 Query: 329 NSKSKRACLVSPAFNTATGIFTDSCND 249 N CL +P N+ + + + +C D Sbjct: 40 NGHCSHLCLPAPRINSKSPLLSCACPD 66 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = -3 Query: 329 NSKSKRACLVSPAFNTATGIFTDSCND 249 N CL +P N+ + + + +C D Sbjct: 40 NGHCSHLCLPAPRINSKSPLLSCACPD 66 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 20.2 bits (40), Expect = 8.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 97 GVTLSESHQSETWD 138 GV LSE + S WD Sbjct: 198 GVDLSEFYMSVEWD 211 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 20.2 bits (40), Expect = 8.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 97 GVTLSESHQSETWD 138 GV LSE + S WD Sbjct: 198 GVDLSEFYMSVEWD 211 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 264 GKNTSRSIESRRD 302 GK+T+ S+E +RD Sbjct: 130 GKSTTTSVEVKRD 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,744 Number of Sequences: 438 Number of extensions: 1976 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -