BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C14 (478 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.5 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.5 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 7.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 9.6 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 22 9.6 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 5.5 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 379 VESKPRCKTRQLHILLLAVFSSSTANRLHFTASRVP 272 +E+ + ++ LH +S++T NR+ +R P Sbjct: 366 IENHRKLLSKDLHACFYPYYSTTTLNRIARFTNRAP 401 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 5.5 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 379 VESKPRCKTRQLHILLLAVFSSSTANRLHFTASRVP 272 +E+ + ++ LH +S++T NR+ +R P Sbjct: 366 IENHRKLLSKDLHACFYPYYSTTTLNRIARFTNRAP 401 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 106 KDVLHQRNIIISKADVSALSICNSLLE 26 KD+ H NI+ D AL I + +LE Sbjct: 880 KDLKHGNNILHIAVDNDALDIVHYILE 906 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.2 bits (45), Expect = 9.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 218 INAAATGMGLLTNSGPQPWHPASSEVK 298 I AA G L ++ + W+PA EVK Sbjct: 2694 IVTAAVGAYLGASAANKSWNPAKWEVK 2720 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 22.2 bits (45), Expect = 9.6 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 305 CRRAAEYC-KEQNVELARLATWFTLNQPHIDTNICGFFNVQQF 430 CR Y QN+ LA+ + I TNI ++N F Sbjct: 119 CRNTPVYAWAGQNIALAQFSRMTNTISQLISTNIASWWNEYSF 161 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 517,297 Number of Sequences: 2352 Number of extensions: 10640 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -